| Sequence 1: | NP_001013757.1 | Gene: | FOXB2 / 442425 | HGNCID: | 23315 | Length: | 432 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_523950.2 | Gene: | bin / 38766 | FlyBaseID: | FBgn0045759 | Length: | 676 | Species: | Drosophila melanogaster |
| Alignment Length: | 351 | Identity: | 73/351 - (20%) |
|---|---|---|---|
| Similarity: | 105/351 - (29%) | Gaps: | 185/351 - (52%) |
- Green bases have known domain annotations that are detailed below.
|
Human 12 QKPPYSYISLTAMAIQHSAEKMLPLSDIYKFIMERFPYYREHTQRWQNSLRHNLSFNDCFIKIPR 76
Human 77 --RPDQPGKGSFWALHPDCGDMFENGSFLRRRKR-----FKV----------------------- 111
Human 112 ------LRADHTHLHAGSTKSAP--------------------------GAGP------------ 132
Human 133 GGHLH------------------------------------------------------------ 137
Human 138 ------------------------PHHHHHPHH-----HHHH-HAAAHHHHHHHPPQPPP----- 167
Human 168 ----------------PPPPPPPHMV 177 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| FOXB2 | NP_001013757.1 | FH_FOXB2 | 1..110 | CDD:410817 | 39/104 (38%) |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 118..220 | 31/209 (15%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 413..432 | ||||
| bin | NP_523950.2 | FH_FOX | 312..391 | CDD:469596 | 31/78 (40%) |
| Blue background indicates that the domain is not in the aligned region. | |||||