DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sip1 and AT2G24830

DIOPT Version :9

Sequence 1:NP_001285636.1 Gene:sip1 / 44238 FlyBaseID:FBgn0024191 Length:839 Species:Drosophila melanogaster
Sequence 2:NP_180056.1 Gene:AT2G24830 / 817020 AraportID:AT2G24830 Length:497 Species:Arabidopsis thaliana


Alignment Length:320 Identity:70/320 - (21%)
Similarity:106/320 - (33%) Gaps:105/320 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 YGIWAD------DSEEESGG-----EGGTKRRGRAARKPKDYTMPVNFVAGGIQQAGKKKKKALQ 89
            |.||..      |.|.:.||     :..:.:.|..:....:|                    |..
plant   194 YDIWRKAELESWDDELQVGGVVFRDDKSSAKLGSDSLALSEY--------------------AQM 238

  Fly    90 ADDEKGSQKEGAEADQGEESDDSAASGRPAFGQNDPGSSNSSSEEERPTLSR-KQPSTTFQHRSH 153
            .||:...::|..|.....:|:||.:|      ..|.||.......|...|.| .|..|..     
plant   239 TDDDGEEEEEEDEQQSASDSEDSVSS------DYDEGSPQGIGFLESTNLPRGVQTDTAL----- 292

  Fly   154 IASERNVGAWEQHTRGIGAKLLLQMGYEPGKGLGKDLQGISHPVQA--------------HVRKG 204
                  ...||.|||||.:|::..|||..|.|||...|||.:|:..              |:|.|
plant   293 ------FAKWENHTRGIASKMMASMGYREGMGLGVSGQGILNPILVKVLPAKRSLDYALEHIRNG 351

  Fly   205 RGAIGAYGPETAASIGGKTNKSIKVDEDVREAKE-----------FKDQL--------------N 244
            .  ..:...:...|.|||..:..|..|..:.||:           ..:|:              |
plant   352 E--CKSEKQKKKRSRGGKRKRGKKFAEAAKAAKQEEESKPDLFSLINEQIFPTRHEKVHSESVKN 414

  Fly   245 KWRKGSAGGAEPMERQGKRYYYKSVE---------EVIAKGHTSGHLLSEKLSKKLGNVR 295
            :..||      |::|:....|...|.         |.:...:....::||..:::|..||
plant   415 RQNKG------PVDRKALVEYQDEVRDLKLEMLKLEQMVNRNKKDLVVSEAATRRLKEVR 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sip1NP_001285636.1 TIP_N 3..93 CDD:289242 11/67 (16%)
G-patch 167..211 CDD:279867 19/57 (33%)
GCFC 416..685 CDD:285127
AT2G24830NP_180056.1 ZnF_C3H1 136..162 CDD:214632
G-patch 300..343 CDD:279867 16/42 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1238995at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.