DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sip1 and zgpat

DIOPT Version :9

Sequence 1:NP_001285636.1 Gene:sip1 / 44238 FlyBaseID:FBgn0024191 Length:839 Species:Drosophila melanogaster
Sequence 2:NP_956779.1 Gene:zgpat / 393457 ZFINID:ZDB-GENE-040426-1248 Length:504 Species:Danio rerio


Alignment Length:306 Identity:81/306 - (26%)
Similarity:124/306 - (40%) Gaps:79/306 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 PAFGQNDPGSSNSSSEEERPTLSRKQPSTTFQHRSHIASERNVG---AWEQHTRGIGAKLLLQMG 179
            |...|:|..||:||..|:........ :..|..|....::.|..   .||.||||||:|||::||
Zfish   257 PPLRQDDVSSSSSSDSEDDAECDGGY-AKVFTSREEDLAQVNTAEFCGWEAHTRGIGSKLLMKMG 320

  Fly   180 YEPGKGLGKDLQGISHPVQAHV-RKGRG---AIGAYGPETAASIGGKTNKSIKVDEDVREAKEFK 240
            ||.||||||.|.|...||||.| .||..   .......:|||:|......|.|     |:||:  
Zfish   321 YELGKGLGKTLSGRVEPVQAVVLPKGHSLDICAELTQRKTAAAIAKNNPTSHK-----RKAKK-- 378

  Fly   241 DQLNKWRKGSAGGAEPMERQGKRYYYKSVEEVIAKGHTSGHLLSEKLSKKLGNVRVIDMTGPEKR 305
                  :|.|.                          ::.|.:.:.|:.|||: |....:.....
Zfish   379 ------KKAST--------------------------STRHNVFDFLNSKLGD-RAQSASHSSSS 410

  Fly   306 VLSGYHALGQAKITPEE---TLYDTEATEKGSAPACVFAMPELTHNLQLLVSQCEQQIIAIDNQE 367
            :::|..|....|.|...   .|:  ||.||                    |:|.|::|..:....
Zfish   411 LVTGAEAYRGGKSTKRSLNVRLF--EAAEK--------------------VTQVEREIQQLTKSL 453

  Fly   368 RECSSQQAALESEHRKLEEIVQLER---NHIRTLEESLERVERLID 410
            .:.:.:.||:.|   :|||.:...|   ..::..|::::|.::..|
Zfish   454 SKRNGRDAAVVS---RLEEKLAASRKLLEQLKAQEQAIQREQKKAD 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sip1NP_001285636.1 TIP_N 3..93 CDD:289242
G-patch 167..211 CDD:279867 27/47 (57%)
GCFC 416..685 CDD:285127
zgpatNP_956779.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..121
ZnF_C3H1 167..190 CDD:214632
TUDOR 211..>241 CDD:119391
G-patch 308..351 CDD:279867 27/42 (64%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1238995at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.