DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sip1 and CG4709

DIOPT Version :9

Sequence 1:NP_001285636.1 Gene:sip1 / 44238 FlyBaseID:FBgn0024191 Length:839 Species:Drosophila melanogaster
Sequence 2:NP_001285788.1 Gene:CG4709 / 34324 FlyBaseID:FBgn0032169 Length:513 Species:Drosophila melanogaster


Alignment Length:358 Identity:93/358 - (25%)
Similarity:146/358 - (40%) Gaps:85/358 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 RGRAARKPKDYTMPVNFVAGGIQQAGKKKKKALQADDEKGSQKE-------GAEADQGEESDDSA 113
            |||        .:.||||    :|..:.:   |...|.|..:::       ....||.|  ||..
  Fly   212 RGR--------VLCVNFV----EQICRVR---LDGQDHKERERDFKFEELYPLTTDQDE--DDEL 259

  Fly   114 ASGRPAFGQNDPGSSNSSS-----EEERPTLSRKQPSTTFQHRSHIASERNVGAWEQHTRGIGAK 173
            :|.......||..|..:.|     ||.|.....:....||:     .:|| :||||:.|||||:|
  Fly   260 SSEESNSSMNDNSSDEAESDMDDLEEARRARMVELSLFTFK-----PTER-LGAWEEFTRGIGSK 318

  Fly   174 LLLQMGYEPGKGLGKDLQGISHPVQAHVRKGRGAIGAYGPETAASIGGKTNKSI----------- 227
            |:.:|||..|.|||.|.:||..||.|.:.....::.|......|:.|.|...|:           
  Fly   319 LMEKMGYIHGTGLGSDGRGIVTPVSAQILPQGRSLDACMELREAANGDKDYFSVERKLKRAQRRQ 383

  Fly   228 -KVDED--VREAKEFKDQLNKWRKGSAGGAEPMERQGKRYYYKSVEEVIAKGHTSGHLLSEKLSK 289
             |.||.  |||::  :..:..:...|..|.....:||        |:|..|..|:.  |.:..:|
  Fly   384 RKADEKAYVRESQ--RVDVFTFLNDSVLGPGESTQQG--------EQVTKKAKTNE--LQQHSTK 436

  Fly   290 KLG--NVRVIDMTGPEKRVLSGYHALGQAKITPEETLYDTEATEKGSAPACVFAMPELTHNLQLL 352
            .|.  .||:.|....::|        ..||:        .::.::.|..|      :|...||:.
  Fly   437 TLNVETVRIADEIRRKQR--------DMAKV--------KQSLDRNSGDA------QLQKRLQVQ 479

  Fly   353 VSQCEQQIIAIDNQERECSSQQAALESEHRKLE 385
            :...:|::..:..|||..|.:|...:|:::..|
  Fly   480 MQSHKQELATLQAQERSLSKEQQTRKSKNKMFE 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sip1NP_001285636.1 TIP_N 3..93 CDD:289242 9/36 (25%)
G-patch 167..211 CDD:279867 20/43 (47%)
GCFC 416..685 CDD:285127
CG4709NP_001285788.1 ZnF_C3H1 155..176 CDD:214632
G-patch 312..355 CDD:279867 20/42 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452033
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1238995at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.