powered by:
Protein Alignment bon and ROS4
DIOPT Version :9
Sequence 1: | NP_001262765.1 |
Gene: | bon / 44235 |
FlyBaseID: | FBgn0023097 |
Length: | 1207 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001326242.1 |
Gene: | ROS4 / 820727 |
AraportID: | AT3G14980 |
Length: | 1189 |
Species: | Arabidopsis thaliana |
Alignment Length: | 74 |
Identity: | 33/74 - (44%) |
Similarity: | 43/74 - (58%) |
Gaps: | 7/74 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 893 DDPNEDWCAVCLDGGELMCCDKCPKVFHQNCHIPAISSLPDESESWQCLLCV--NIKELTKTEGS 955
||||:|.|.||.|||||:|||.||..|||.| .::..||: .||.|..|. ...||. ::.:
plant 722 DDPNDDSCGVCGDGGELICCDNCPSTFHQAC--LSMQVLPE--GSWYCSSCTCWICSELV-SDNA 781
Fly 956 EKSSSGELS 964
|:|...:.|
plant 782 ERSQDFKCS 790
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm3092 |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.