DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bon and AT2G36720

DIOPT Version :9

Sequence 1:NP_001262765.1 Gene:bon / 44235 FlyBaseID:FBgn0023097 Length:1207 Species:Drosophila melanogaster
Sequence 2:NP_001324556.1 Gene:AT2G36720 / 818244 AraportID:AT2G36720 Length:1007 Species:Arabidopsis thaliana


Alignment Length:307 Identity:64/307 - (20%)
Similarity:105/307 - (34%) Gaps:90/307 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   855 SNGVQVLPEGRTKTTSPQVHSSTDLSNTQEVNNKNEQKDDPNEDWCAVCLDGGELMCCDKCPKVF 919
            ||||. |.|..|..:..:.:|:.|                 |.|.|.:|.|||.|:.||.||:.|
plant   591 SNGVS-LHEWATTFSHGRKYSAND-----------------NNDLCVICADGGNLLLCDSCPRAF 637

  Fly   920 HQNCHIPAISSLPDESESWQCLLCVN--IKELTKTEGSEKSSSGELSALE-LRILQRICLELYCQ 981
            |..|  .::.|:|  ..:|.|..|.|  ..|:........|:.|:|..:: :..|...|:.:...
plant   638 HIEC--VSLPSIP--RGNWHCKYCENKFTSEIAGEYNVNSSAVGQLEGVDPVDQLAGRCIRVVKN 698

  Fly   982 YEQSLNFREPESPANTSYYEIVSSPMSLDVIRTRLDPSSPNHYKDIAGFVSDVRLIFSNTYLFYQ 1046
            .|           |.|:...:.|..   |..|:...|                     .|.:...
plant   699 ME-----------AETNGCVLCSGS---DFCRSGFGP---------------------RTIIICD 728

  Fly  1047 EDTKTYS----NAKYLENFFEEQLAKWLPQFEGTKPQGKRNTSNSPALLGVNATGSPSPIENGRK 1107
            :..|.|.    :::.:.:..|.....|....:.|    :.|::....|||               
plant   729 QCEKEYHIGCLSSQNIVDLKELPKGNWFCSMDCT----RINSTLQKLLLG--------------- 774

  Fly  1108 SCGSASLGDSDGACLPAKRARRSAHEXNEL-----MPGGKGTDGEQQ 1149
              |:..|.||....:..|:.|...:..::|     :..||.|..|.:
plant   775 --GAEKLSDSSLGIIQTKQERNDVYSISDLDIRWRLISGKVTSPESR 819

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bonNP_001262765.1 zf-RING_5 82..130 CDD:291308
BBOX 239..275 CDD:237988
BBC 284..409 CDD:128778
PHD_TIF1_like 899..943 CDD:277016 17/43 (40%)
Bromo_tif1_like 963..1072 CDD:99934 15/113 (13%)
AT2G36720NP_001324556.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3092
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.