DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bon and ftr79

DIOPT Version :9

Sequence 1:NP_001262765.1 Gene:bon / 44235 FlyBaseID:FBgn0023097 Length:1207 Species:Drosophila melanogaster
Sequence 2:XP_697299.3 Gene:ftr79 / 568850 ZFINID:ZDB-GENE-060126-4 Length:663 Species:Danio rerio


Alignment Length:390 Identity:85/390 - (21%)
Similarity:143/390 - (36%) Gaps:86/390 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 FKCVYCAQLLGSNDRPKLLECLHVACAQCVSTKFSELDRSLPPLIHCPVCDNASQQEF------- 138
            :.|..|..||..   |..:.|.|..|..|::..::: |::.|  ..||.|    :|.|       
Zfish    40 YSCSVCLDLLKD---PVTIPCGHSYCMSCINECWNK-DQNGP--YKCPQC----RQTFSSKPPLN 94

  Fly   139 -------IVDNQFLIEQCTAGDSGDGVGLLGLTGEGQKSSAAASIQCSSC-SDGAVATSWCVDCS 195
                   |:||                  |......|..:....|.|..| .:...|...|::|.
Zfish    95 RSTVLAEIMDN------------------LRAKESPQSPAGPGEIACDFCVGESIKAVKSCLECR 141

  Fly   196 EYICDSCVQAHQRLKITKDHTIKPKDEANNEQLAGAAGVDKLHMCQLHPQEKLSLFCETCDKLTC 260
            ...|:..||.|..:...|.|.:              .....:.:|..| .:.|.::|.|.....|
Zfish   142 ASYCELHVQPHYNVPALKKHVL--------------VKASTIPVCSKH-DKLLEVYCRTDQTCVC 191

  Fly   261 RDCQLSDHRDH-----------KYKFAHEIATESRQALSTLVSEI-NYKRFLLSSATKVIDDRQQ 313
            ..|.:.||:.|           |.....:..|:.:|.:.....|: ..|:.::|.:    |..:.
Zfish   192 AHCLMDDHKGHDTVPSTTERKEKEMQLKDTQTKVKQTIQAKEKELQKMKKDIMSHS----DSTKA 252

  Fly   314 LIHDKKK---DLIKEITAMAVKITNTVNTRGKQLI---MRLNEVCDSKLKVLVEKKETLQLLSDN 372
            .:.:.|.   ||:|.|...:.::|..:..:.|..:   .:|.|....::..|.:::..|:.|| :
Zfish   253 AVENSKNVFTDLVKLIEKRSSEMTEKIKAQEKADLDQGRKLQEKVKVEITHLKKREGVLETLS-H 316

  Fly   373 TDHCIDFMQN---ALEKGSD-FAILSSKKSL-VRHLQKLKCQRADIPNPEIPVRIQVQLNQVSDL 432
            ||:.|.|:||   .|..||| |...|.|... ...:.||.||..:........:|.....:||||
Zfish   317 TDNNIHFLQNYESVLCSGSDGFPSHSFKPGCSYTDVNKLLCQLKEQLEAVFNQKINETFQKVSDL 381

  Fly   433  432
            Zfish   382  381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bonNP_001262765.1 zf-RING_5 82..130 CDD:291308 13/47 (28%)
BBOX 239..275 CDD:237988 11/46 (24%)
BBC 284..409 CDD:128778 33/136 (24%)
PHD_TIF1_like 899..943 CDD:277016
Bromo_tif1_like 963..1072 CDD:99934
ftr79XP_697299.3 RING_Ubox 41..84 CDD:327409 14/52 (27%)
zf-B_box 167..206 CDD:306989 10/39 (26%)
OmpH 210..>309 CDD:332039 17/102 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.