DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fray and STRADA

DIOPT Version :9

Sequence 1:NP_001303449.2 Gene:fray / 44233 FlyBaseID:FBgn0023083 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_001003787.1 Gene:STRADA / 92335 HGNCID:30172 Length:431 Species:Homo sapiens


Alignment Length:382 Identity:119/382 - (31%)
Similarity:170/382 - (44%) Gaps:72/382 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 GTPPPHTVAPGNGTASSRSMTSIPANLSSNNVAGAATLPGAAAPPEKYTWPNSKDDYELRDVIGV 201
            |..||.........|||.|:.|.     |.....::.||....             |||..|||.
Human    31 GEQPPGDTRRKTNDASSESIASF-----SKQEVMSSFLPEGGC-------------YELLTVIGK 77

  Fly   202 G--ATAVVHGAYCIPRNEKCAIKRINLEKWNTSMDELLKEIQAMSSCF-HENVVTYHTSFVVREE 263
            |  ....|:.|...|..|...::|||||..:..|...|:....:|..| |.|:|.|..:|:...|
Human    78 GFEDLMTVNLARYKPTGEYVTVRRINLEACSNEMVTFLQGELHVSKLFNHPNIVPYRATFIADNE 142

  Fly   264 LWLVLRLLEGGSLLDII-KHKMRTSNCKQGVFDEATIATVLKEVLKGLEYFHSNGQIHRDIKAGN 327
            ||:|...:..||..|:| .|.|...|       |..||.:|:.|||.|:|.|..|.:||.:||.:
Human   143 LWVVTSFMAYGSAKDLICTHFMDGMN-------ELAIAYILQGVLKALDYIHHMGYVHRSVKASH 200

  Fly   328 ILIGDDGTIQIADFGVSAWLATGRDLSRQKVRHTF----VGTPCWMAPEVMEQD-HGYDFKADIW 387
            |||..||.:.::  |:.:.|:......||:|.|.|    |....|::|||::|: .|||.|:||:
Human   201 ILISVDGKVYLS--GLRSNLSMISHGQRQRVVHDFPKYSVKVLPWLSPEVLQQNLQGYDAKSDIY 263

  Fly   388 SFGITAIEMATGTAPYHKYPPMKVLMLTLQNDPPTL--------------------DTGADDK-- 430
            |.||||.|:|.|..|:...|..::|:..|....|.|                    ::|..|.  
Human   264 SVGITACELANGHVPFKDMPATQMLLEKLNGTVPCLLDTSTIPAEELTMSPSRSVANSGLSDSLT 328

  Fly   431 --------------DQYKAYGKTFRKMIVECLQKEPSKRPTASELLKHAFFKKAKDR 473
                          ..::.:...|...:.:|||:.|..||:||.||.|:|||:.|.|
Human   329 TSTPRPSNGDSPSHPYHRTFSPHFHHFVEQCLQRNPDARPSASTLLNHSFFKQIKRR 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
frayNP_001303449.2 STKc_OSR1_SPAK 191..467 CDD:270787 103/320 (32%)
OSR1_C 613..670 CDD:403428
STRADANP_001003787.1 S_TKc 69..379 CDD:214567 103/318 (32%)
PK_STRAD_alpha 70..396 CDD:173767 107/325 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 310..347 2/36 (6%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0582
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.