DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fray and AT1G70430

DIOPT Version :9

Sequence 1:NP_001303449.2 Gene:fray / 44233 FlyBaseID:FBgn0023083 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_001323342.1 Gene:AT1G70430 / 843379 AraportID:AT1G70430 Length:609 Species:Arabidopsis thaliana


Alignment Length:353 Identity:146/353 - (41%)
Similarity:206/353 - (58%) Gaps:38/353 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 VAGAATLPGAAAPPEKYTWPNSKDDYELRDVIGVGATAVVHGAYCIPRNEKCAIKRINLEKWNTS 232
            :||::|          ..:|....||||.:.:|.|.:|.|:.|.||..||..|:|.::|||....
plant     1 MAGSST----------KRFPLYAKDYELFEEVGEGVSATVYRARCIALNEIVAVKILDLEKCRND 55

  Fly   233 MDELLKEIQAMSSCFHENVVTYHTSFVVREELWLVLRLLEGGSLLDIIKHKMRTSNCKQGVFDEA 297
            ::.:.||:..||...|.|::..|.||:....||:|:..:.|||...::|     |...:|: ::.
plant    56 LETIRKEVHIMSLIDHPNLLKAHCSFIDSSSLWIVMPYMSGGSCFHLMK-----SVYPEGL-EQP 114

  Fly   298 TIATVLKEVLKGLEYFHSNGQIHRDIKAGNILIGDDGTIQIADFGVSAWLATGRDLSRQKVRHTF 362
            .|||:|:||||.|.|.|..|.||||:|||||||...|.:::.||||||.:....:  |.:.|:||
plant   115 IIATLLREVLKALVYLHRQGHIHRDVKAGNILIHSKGVVKLGDFGVSACMFDSGE--RMQTRNTF 177

  Fly   363 VGTPCWMAPEVMEQDHGYDFKADIWSFGITAIEMATGTAPYHKYPPMKVLMLTLQNDPPTLDTGA 427
            ||||||||||||:|..|||||           .:|.|.||:.||||||||::||||.||.||.  
plant   178 VGTPCWMAPEVMQQLDGYDFK-----------YLAHGHAPFSKYPPMKVLLMTLQNAPPRLDY-- 229

  Fly   428 DDKDQYKAYGKTFRKMIVECLQKEPSKRPTASELLKHAFFKKAKDRKYLTQTLLQSGPSMETRVH 492
             |:|  |.:.|:||::|..||.|:|.|||||::||||.|||.|:...||::.:|.....:..|..
plant   230 -DRD--KKFSKSFRELIAACLVKDPKKRPTAAKLLKHPFFKHARSTDYLSRKILHGLSPLGERFK 291

  Fly   493 KAAKRQPGASGRLHRTVTGEWVWSSEEE 520
            |..:    |...|.:.:.|:....|:.|
plant   292 KLKE----AEAELFKGINGDKEQLSQHE 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
frayNP_001303449.2 STKc_OSR1_SPAK 191..467 CDD:270787 128/275 (47%)
OSR1_C 613..670 CDD:403428
AT1G70430NP_001323342.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 289 1.000 Domainoid score I366
eggNOG 1 0.900 - - E1_KOG0582
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D855861at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2448
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1048
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.