DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fray and ATMAP4K ALPHA1

DIOPT Version :9

Sequence 1:NP_001303449.2 Gene:fray / 44233 FlyBaseID:FBgn0023083 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_001185209.1 Gene:ATMAP4K ALPHA1 / 841750 AraportID:AT1G53165 Length:688 Species:Arabidopsis thaliana


Alignment Length:423 Identity:140/423 - (33%)
Similarity:216/423 - (51%) Gaps:71/423 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 DVIGVGATAVVHGAYCIPRNEKCAIKRINLEKWNTSMDELLKEIQAMSSCFHENVVTYHTSFVVR 261
            ::||.|:...|:.|:....|:..|||.|:||:....::::.|||..:|.|....:..|:.|::.:
plant    19 ELIGRGSFGDVYKAFDTELNKDVAIKVIDLEESEDEIEDIQKEISVLSQCRCPYITEYYGSYLHQ 83

  Fly   262 EELWLVLRLLEGGSLLDIIKHKMRTSNCKQGVFDEATIATVLKEVLKGLEYFHSNGQIHRDIKAG 326
            .:||:::..:.|||:.|:::        .....||.:||.:.:::|..:||.|:.|:|||||||.
plant    84 TKLWIIMEYMAGGSVADLLQ--------PGNPLDEISIACITRDLLHAVEYLHAEGKIHRDIKAA 140

  Fly   327 NILIGDDGTIQIADFGVSAWLATGRDLSRQKVRHTFVGTPCWMAPEVMEQDHGYDFKADIWSFGI 391
            |||:.::|.:::|||||||.|.  |.:||:|   ||||||.||||||::...||:.||||||.||
plant   141 NILLSENGDVKVADFGVSAQLT--RTISRRK---TFVGTPFWMAPEVIQNSEGYNEKADIWSLGI 200

  Fly   392 TAIEMATGTAPYHKYPPMKVLMLTLQNDPPTLDTGADDKDQYKAYGKTFRKMIVECLQKEPSKRP 456
            |.||||.|..|.....||:||.:..:..||.||         :.:.:..::.:..||:|.|::||
plant   201 TMIEMAKGEPPLADLHPMRVLFIIPRESPPQLD---------EHFSRPLKEFVSFCLKKAPAERP 256

  Fly   457 TASELLKHAFFKKAKDRKYLTQTLLQ--------------SGP------SMETRVHKAAKRQPGA 501
            .|.|||||.|.|.|:....|.:.:.:              :||      |...||.|..:.| |.
plant   257 NAKELLKHRFIKNARKSPKLLERIRERPKYQVKEDEEIPTNGPKAPAESSGTVRVAKDERGQ-GT 320

  Fly   502 SG-RLH---------RTV-TGEWVWSSEEEDNGGSATGSGTGDRKHPSSDSDSEDRPMNRLERAD 555
            || ||.         :|| ...|.:|.      |.:.|:||.....|         |..|..|.:
plant   321 SGTRLDKWLDKCFQVKTVRNAGWDFSI------GGSQGAGTVRALKP---------PQARERRQE 370

  Fly   556 SSDSDREEPSPEITHSVSSATVTPGAPAAAGAG 588
            .:.:...:.:...:.|..|:|.  |.|..:..|
plant   371 VNSNQTSQKTSRTSGSQLSSTF--GVPEISEGG 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
frayNP_001303449.2 STKc_OSR1_SPAK 191..467 CDD:270787 106/269 (39%)
OSR1_C 613..670 CDD:403428
ATMAP4K ALPHA1NP_001185209.1 STKc_MST3_like 14..287 CDD:270786 110/289 (38%)
S_TKc 19..267 CDD:214567 106/269 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.