DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fray and STRADB

DIOPT Version :9

Sequence 1:NP_001303449.2 Gene:fray / 44233 FlyBaseID:FBgn0023083 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_061041.2 Gene:STRADB / 55437 HGNCID:13205 Length:418 Species:Homo sapiens


Alignment Length:404 Identity:119/404 - (29%)
Similarity:172/404 - (42%) Gaps:101/404 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 PRSQSQPAINNRRRPGTPPPHTVAPGNGTAS-SRSMTSIPANLSSNNVAGAATLPGAAAPPEKYT 185
            |..||:.:|           |.......|.| ||..|.....|.|.||:                
Human    19 PEKQSETSI-----------HQYLVDEPTLSWSRPSTRASEVLCSTNVS---------------- 56

  Fly   186 WPNSKDDYELRDVIGVGATAV--VHGAYCIPRNEKCAIKRINLEKWNTSMDELLKEIQ---AMSS 245
                  .|||:..||.|...:  ||.|...|......||..|||..|   :|.||.:|   .:|.
Human    57 ------HYELQVEIGRGFDNLTSVHLARHTPTGTLVTIKITNLENCN---EERLKALQKAVILSH 112

  Fly   246 CF-HENVVTYHTSFVVREELWLVLRLLEGGSLLDIIKHKMRTSNCKQGVFDEATIATVLKEVL-- 307
            .| |.|:.||.|.|.|...||::...:..||...:    :||      .|.|....|:::.:|  
Human   113 FFRHPNITTYWTVFTVGSWLWVISPFMAYGSASQL----LRT------YFPEGMSETLIRNILFG 167

  Fly   308 --KGLEYFHSNGQIHRDIKAGNILIGDDGTIQIADFGVSAWLATGRDLSRQKVRHTF----VGTP 366
              :||.|.|.||.|||.|||.:|||..||.:.::  |:|...:..:...|.:..:.|    ....
Human   168 AVRGLNYLHQNGCIHRSIKASHILISGDGLVTLS--GLSHLHSLVKHGQRHRAVYDFPQFSTSVQ 230

  Fly   367 CWMAPEVMEQD-HGYDFKADIWSFGITAIEMATGTAPYH------------KYPPMKVLMLT--- 415
            .|::||::.|| |||:.|:||:|.||||.|:|:|..|:.            |.||...|.::   
Human   231 PWLSPELLRQDLHGYNVKSDIYSVGITACELASGQVPFQDMHRTQMLLQKLKGPPYSPLDISIFP 295

  Fly   416 -----LQNDPPTLDTGADDK-----------------DQYKAYGKTFRKMIVECLQKEPSKRPTA 458
                 ::|....:|:|..:.                 ...|.:...|..::..|||::|.|||:|
Human   296 QSESRMKNSQSGVDSGIGESVLVSSGTHTVNSDRLHTPSSKTFSPAFFSLVQLCLQQDPEKRPSA 360

  Fly   459 SELLKHAFFKKAKD 472
            |.||.|.|||:.|:
Human   361 SSLLSHVFFKQMKE 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
frayNP_001303449.2 STKc_OSR1_SPAK 191..467 CDD:270787 101/327 (31%)
OSR1_C 613..670 CDD:403428
STRADBNP_061041.2 PK_STRAD_beta 59..386 CDD:270864 104/331 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0582
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.