DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fray and Stradb

DIOPT Version :9

Sequence 1:NP_001303449.2 Gene:fray / 44233 FlyBaseID:FBgn0023083 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_001102777.2 Gene:Stradb / 501146 RGDID:1559449 Length:418 Species:Rattus norvegicus


Alignment Length:336 Identity:103/336 - (30%)
Similarity:151/336 - (44%) Gaps:75/336 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 YELRDVIGVGATAV--VHGAYCIPRNEKCAIKRINLEKWNTSMDELLKEIQ---AMSSCF-HENV 251
            |||...||.|...:  ||.|...|......||..|||   |..||.|:.:|   .:|..| |.|:
  Rat    58 YELHVEIGRGFDNLTSVHLARHTPTGTLVTIKITNLE---TCTDERLRALQRAVILSHFFQHPNI 119

  Fly   252 VTYHTSFVVREELWLVLRLLEGGSLLDIIKHKMRTSNCKQGVFDEATIATVLKEVL----KGLEY 312
            .||.|.|.|...||::...:..||...:    :||      .|.:....|:::.:|    :||.|
  Rat   120 TTYWTVFTVGSWLWVIYPFMAYGSASQL----LRT------YFPDGMSETLIRNILFGAVRGLNY 174

  Fly   313 FHSNGQIHRDIKAGNILIGDDGTIQIADFGVSAWLATGRDLSRQKVRHTFV--------GTPCWM 369
            .|.||.|||..||.:|||..||.:.::.      |:....|.:...||..|        ....|:
  Rat   175 LHQNGCIHRSFKASHILISGDGLVTLSG------LSHLHSLVKHGQRHRAVFDFPQFSTSVQPWL 233

  Fly   370 APEVMEQD-HGYDFKADIWSFGITAIEMATGTAPYH------------KYPPMKVLMLT------ 415
            :||::.|| |||:.|:||:|.||||.|:|:|..|:.            |.||...|.::      
  Rat   234 SPELLRQDLHGYNVKSDIYSVGITACELASGQVPFQDMHSTQMLLQKLKGPPYSPLDVSIFPQSD 298

  Fly   416 --LQNDPPTLDTGADDK-----------------DQYKAYGKTFRKMIVECLQKEPSKRPTASEL 461
              ::|....:|:|..:.                 ...:.:...|..::..|||::|.|||:||.|
  Rat   299 SRMRNSQSGVDSGIGESVLVSTGTHTVNSDRLHTPSTRTFSPAFFSLVQLCLQQDPEKRPSASSL 363

  Fly   462 LKHAFFKKAKD 472
            |.|.|||:.|:
  Rat   364 LSHVFFKQMKE 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
frayNP_001303449.2 STKc_OSR1_SPAK 191..467 CDD:270787 99/329 (30%)
OSR1_C 613..670 CDD:403428
StradbNP_001102777.2 S_TKc 58..369 CDD:214567 99/329 (30%)
PK_STRAD_beta 59..386 CDD:270864 102/335 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0582
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.