DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fray and Pak

DIOPT Version :9

Sequence 1:NP_001303449.2 Gene:fray / 44233 FlyBaseID:FBgn0023083 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_001138013.2 Gene:Pak / 44039 FlyBaseID:FBgn0267698 Length:840 Species:Drosophila melanogaster


Alignment Length:448 Identity:146/448 - (32%)
Similarity:205/448 - (45%) Gaps:83/448 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 TEQEQRRESENEHPSVYRQQDEEFHPIKKEEPQKTPPISKQPRPRNTPRSQ--SQPAINNRRRPG 137
            |.......|.:..|| :...|...|.:         |....|.|.::.|:.  |.|.       .
  Fly   426 TNHHSSASSFSSFPS-FHDDDGTHHAL---------PTIHCPTPTSSSRNSTVSFPV-------A 473

  Fly   138 TPPPHTVAPGNGTASS----------RSMTSIPANLSSNNVAG-------AATLPGA-----AAP 180
            .|.|..|.|.:.|.:|          .::..:.|...|:.|||       ||..|.|     ||.
  Fly   474 VPLPPIVTPASPTPASIESPDLYTPEPTVAQVSAGGPSSQVAGNQIAVPQAAVAPAATPNTRAAN 538

  Fly   181 PEKYTW-----------------PNSKDDYELRDVIGVGATAVVHGAYCIPRNEKCAIKRINLEK 228
            .:|...                 ||.|  |...:.||.||:..|:.|.......:.|||::||.:
  Fly   539 AKKKKMSDEEILEKLRTIVSVGDPNRK--YTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQ 601

  Fly   229 WNTSMDELLKEIQAMSSCFHENVVTYHTSFVVREELWLVLRLLEGGSLLDIIKHKMRTSNCKQGV 293
             ....:.::.||..|....|.|||.|..|::|.||||:|:..|.||||.|::     |..|    
  Fly   602 -QPKKELIINEILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVV-----TETC---- 656

  Fly   294 FDEATIATVLKEVLKGLEYFHSNGQIHRDIKAGNILIGDDGTIQIADFGVSAWLATGRDLSRQKV 358
            .||..||.|.:|||:.||:.|:|..||||||:.|||:|.||::::.|||..|.::     ..|..
  Fly   657 MDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQIS-----PEQSK 716

  Fly   359 RHTFVGTPCWMAPEVMEQDHGYDFKADIWSFGITAIEMATGTAPYHKYPPMKVLMLTLQNDPPTL 423
            |.|.||||.||||||:.:.. |..|.|:||.||.||||..|..||....|:|.|.|...|..|.:
  Fly   717 RTTMVGTPYWMAPEVVTRKQ-YGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEI 780

  Fly   424 DTGADDKDQYKAYGKTFRKMIVECLQKEPSKRPTASELLKHAFFKKAKDRKYLTQTLL 481
                .:||:..:   .|:..:.:||:.|..:|.:|.:||||.|.|.|:....||..::
  Fly   781 ----KEKDKLSS---AFQDFLDQCLEVEVDRRASALDLLKHPFLKLARPLASLTPLIM 831

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
frayNP_001303449.2 STKc_OSR1_SPAK 191..467 CDD:270787 108/275 (39%)
OSR1_C 613..670 CDD:403428
PakNP_001138013.2 PBD 83..137 CDD:279166
STKc_PAK_I 558..818 CDD:270814 112/284 (39%)
S_TKc 566..817 CDD:214567 108/273 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438567
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.