DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fray and GckIII

DIOPT Version :9

Sequence 1:NP_001303449.2 Gene:fray / 44233 FlyBaseID:FBgn0023083 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_650596.1 Gene:GckIII / 42064 FlyBaseID:FBgn0266465 Length:642 Species:Drosophila melanogaster


Alignment Length:547 Identity:173/547 - (31%)
Similarity:249/547 - (45%) Gaps:101/547 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 TWPNSKDDYEL----RDVIGVGATAVVHGAYCIPRNEKCAIKRINLEKWNTSMDELLKEIQAMSS 245
            :| ..|.|.||    ::.||.|:...|.........:..|||.|:||:....:|::.:||..:|.
  Fly     2 SW-TEKVDPELIFTKQERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIDDIQQEIMVLSQ 65

  Fly   246 CFHENVVTYHTSFVVREELWLVLRLLEGGSLLDIIKHKMRTSNCKQGVFDEATIATVLKEVLKGL 310
            |....|..|:.||:...:||:::..|.|||.||::         |.|.|:|..|..:|:||||||
  Fly    66 CDSPYVTKYYGSFLKGTKLWIIMEYLGGGSALDLM---------KAGSFEEMHIGIILREVLKGL 121

  Fly   311 EYFHSNGQIHRDIKAGNILIGDDGTIQIADFGVSAWLATGRDLSRQKVRHTFVGTPCWMAPEVME 375
            :|.||..::||||||.|:|:.:.|.:::|||||:     |:..:....|:||||||.||||||::
  Fly   122 DYLHSERKLHRDIKAANVLLSEQGDVKLADFGVA-----GQLTNTTSKRNTFVGTPFWMAPEVIK 181

  Fly   376 QDHGYDFKADIWSFGITAIEMATGTAPYHKYPPMKVLMLTLQNDPPTLDTGADDKDQYKAYGKTF 440
            |.. ||.||||||.||||||:|.|..|..:..||:||.|..:|:||.| ||        :|.|:|
  Fly   182 QSQ-YDAKADIWSLGITAIELAKGEPPNSELHPMRVLFLIPKNNPPQL-TG--------SYTKSF 236

  Fly   441 RKMIVECLQKEPSKRPTASELLKHAFFKKAKDRKYLTQTLLQSGPSMETRVHKAAKRQPGASGRL 505
            :..:..||.|:|..||||.||||:.|.||||...||...:        .|..|            
  Fly   237 KDFVEACLNKDPENRPTAKELLKYPFIKKAKKNAYLIDLI--------DRFKK------------ 281

  Fly   506 HRTVTGEWVWSSEEEDNGGSATGSGTGDRKHPSSDSDSEDRP---------MNRLERADSSDSDR 561
                   |..|..:|....|.......|.|...|   |:|.|         :|...||..:....
  Fly   282 -------WKVSKGDESETESENSDSDSDAKQGGS---SQDEPWIMTVKGLHINSAPRAGVNSFQL 336

  Fly   562 EEPS------PEITHSVSSATVTPGAPA-----------AAGAGAAQELTA--GIAQLPLPSEAA 607
            :|..      .:.|||.:.......:||           ||.|.:...:||  |::       :|
  Fly   337 QEHELTMQKLMQTTHSPAGGGGVQASPAANALSSSVSAVAASASSVSVITANEGVS-------SA 394

  Fly   608 GEAPPVNLVLRMRNLRRELHDIRFEFVVGKDTAEGIATELVDAGLVDALDTQPMATHLDQLIAAS 672
            ...||.|..:...|    .::|....:..........|.|..|....::.:...|:.|.|..::|
  Fly   395 SALPPQNSHVHNHN----HNNINNNNIRNLSNKHATTTMLNAAPPPSSVTSSSSASELQQKRSSS 455

  Fly   673 ATMKTITFQLSSGVQPGEVPDERSLVG 699
               |....|..|.....:|.|.|:.:|
  Fly   456 ---KPELRQSRSAAPLDQVEDRRASLG 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
frayNP_001303449.2 STKc_OSR1_SPAK 191..467 CDD:270787 117/279 (42%)
OSR1_C 613..670 CDD:403428 9/56 (16%)
GckIIINP_650596.1 STKc_MST3_like 12..283 CDD:270786 123/321 (38%)
S_TKc 13..263 CDD:214567 114/273 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438548
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR48012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.