DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fray and strada

DIOPT Version :9

Sequence 1:NP_001303449.2 Gene:fray / 44233 FlyBaseID:FBgn0023083 Length:707 Species:Drosophila melanogaster
Sequence 2:XP_021325312.1 Gene:strada / 334550 ZFINID:ZDB-GENE-030131-6482 Length:442 Species:Danio rerio


Alignment Length:431 Identity:123/431 - (28%)
Similarity:190/431 - (44%) Gaps:104/431 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 QPRPRNTPRSQSQPAINNRRRPGTPPPHTVAPGNGTASSRSMTSIPANLSSNNVAGAATLPGAAA 179
            |..|.......|:.::|       |.||....|                        :.||.::|
Zfish    41 QASPLRKAHEDSRESLN-------PLPHRDTMG------------------------SFLPDSSA 74

  Fly   180 PPEKYTWPNSKDDYELRDVIGVGATAV--VHGAYCIPRNEKCAIKRINLEKWNTSMDELLKEIQA 242
                         ||||:|||.|..::  |:.|...|..|..||:||:|:.....|...|:....
Zfish    75 -------------YELRNVIGRGLESLMTVNLAVYKPTGEYVAIRRIDLDSCANDMVSYLQGELR 126

  Fly   243 MSSCFHEN-VVTYHTSFVVREELWLVLRLLEGGSLLDIIKHKMRTSNCKQGVFDEATIATVLKEV 306
            :|..||.. ::.|.:.|:...|||::...:..||..|:|     .::...|: :|.|||.:|..|
Zfish   127 VSKLFHHPCILPYKSVFIAENELWVITPFMAYGSARDLI-----ITHFTDGL-NEQTIAYILLGV 185

  Fly   307 LKGLEYFHSNGQIHRDIKAGNILIGDDGTIQIADFGVSAWLATGRDLSRQKVRHTF----VGTPC 367
            |:.|||.|..|.:||.:||.:|||..||.:.::  |:.:..:..|...|.:|.|.|    |....
Zfish   186 LRALEYIHQMGYVHRSVKASHILISADGQMFLS--GLRSIFSLIRHGQRARVVHDFPQYSVKVLP 248

  Fly   368 WMAPEVMEQD-HGYDFKADIWSFGITAIEMATGTAPYHKYPPMKVLMLTLQNDPP-TLDT----- 425
            |::|||::|: .||||::||:|.||||.|:|.|..|:...|..::|:..|....| .|||     
Zfish   249 WLSPEVLQQNLQGYDFRSDIYSLGITACELANGHVPFKDMPATQMLLEKLNGTVPCLLDTTTIPP 313

  Fly   426 ----------GADD------------------------KDQYKAYGKTFRKMIVECLQKEPSKRP 456
                      |||.                        ....:.:...|...:..|||::|.|||
Zfish   314 EELSMKPSRSGADSGICEGPGAGGARHTNGEPSSSSGGNPYSRTFSSHFHAFVELCLQRDPEKRP 378

  Fly   457 TASELLKHAFFKKAKDR--KYLTQTLLQSGP--SMETRVHK 493
            :||.|:.|:|||:.|.|  :.|.:.|....|  |:::..|:
Zfish   379 SASSLIGHSFFKQIKRRPSEALPELLRPVSPISSLDSMQHQ 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
frayNP_001303449.2 STKc_OSR1_SPAK 191..467 CDD:270787 102/323 (32%)
OSR1_C 613..670 CDD:403428
stradaXP_021325312.1 PKc_like 76..406 CDD:328722 108/337 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0582
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.