DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fray and ppk11

DIOPT Version :9

Sequence 1:NP_001303449.2 Gene:fray / 44233 FlyBaseID:FBgn0023083 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_594517.1 Gene:ppk11 / 2541473 PomBaseID:SPAC2C4.14c Length:312 Species:Schizosaccharomyces pombe


Alignment Length:326 Identity:117/326 - (35%)
Similarity:169/326 - (51%) Gaps:23/326 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 KDDYELRDVIGVGATAVVHGAYCIPRNEKCAIKRINLEKWNTSMDELLKEIQAMSSCFHENVVTY 254
            |..|....:||.|:...|..|..:..::..|:|.::|:.....::.|.:||..:......::..|
pombe     3 KHQYRDLQLIGQGSFGSVFRAQDVESSKIVALKVVDLDATKDQIETLTQEINFLIDLNSVHITKY 67

  Fly   255 HTSFVVREELWLVLRLLEGGSLLDIIKHKMRTSNCKQGVFDEATIATVLKEVLKGLEYFHSNGQI 319
            :.|||....||:.:...:|||.||::|        ..|.|.|..||.|:::||:.|.|.|..|::
pombe    68 YASFVDGFRLWITMEYCDGGSCLDLLK--------LSGTFSERVIAEVMRQVLEALVYLHGQGKM 124

  Fly   320 HRDIKAGNILIGDDGTIQIADFGVSAWLATGRDLSRQKVRHTFVGTPCWMAPEVMEQDHGYDFKA 384
            ||||||.|||...||.:::||||||..|.:.||.:     ..|||||.||||||::|. ||::||
pombe   125 HRDIKAANILTMKDGLVKLADFGVSGQLESLRDKN-----DDFVGTPFWMAPEVVKQT-GYNYKA 183

  Fly   385 DIWSFGITAIEMATGTAPYHKYPPMKVLMLTLQNDPPTLDTGADDKDQYKAYGKTFRKMIVECLQ 449
            ||||.||||.|:|||..||....|||||:|..::.||:|:.        ..:.:.|...:..||:
pombe   184 DIWSLGITAYELATGEPPYSGIHPMKVLLLIPKHSPPSLER--------SKFSRAFCDFVSNCLK 240

  Fly   450 KEPSKRPTASELLKHAFFKKAKDRKYLTQTLLQSGPSMETRVHKAAKRQPGASGRLHRTVTGEWV 514
            |.|..|.||..|.||.|.||......:.:.:.......|:.:...|.......|....|: .|.|
pombe   241 KNPKDRATAEYLSKHKFIKKYCPNTSVKEVVASYAKWKESELLPEATPYNSTMGNSANTI-DEVV 304

  Fly   515 W 515
            |
pombe   305 W 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
frayNP_001303449.2 STKc_OSR1_SPAK 191..467 CDD:270787 106/275 (39%)
OSR1_C 613..670 CDD:403428
ppk11NP_594517.1 STKc_MST3_like 4..278 CDD:270786 109/295 (37%)
S_TKc 6..258 CDD:214567 106/273 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.