DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-PDSW and AT3G18410

DIOPT Version :9

Sequence 1:NP_651972.1 Gene:ND-PDSW / 44228 FlyBaseID:FBgn0021967 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001118655.1 Gene:AT3G18410 / 821370 AraportID:AT3G18410 Length:106 Species:Arabidopsis thaliana


Alignment Length:124 Identity:29/124 - (23%)
Similarity:46/124 - (37%) Gaps:34/124 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RFRRVPTIDQCYTD---------DAVCRFEADQQFRRDRMVDNEIVNILRQRFEDCTLYEAPDHM 99
            |.:.:|..::...|         |.|...|..:...|::.:..|...|||::.:.|...|..:|.
plant     3 RKKGLPEFEESAPDGFDPENPYKDPVAMVEMREHIVREKWIQIEKAKILREKVKWCYRVEGVNHY 67

  Fly   100 VKCRPLMDQYEKATENWFIKYGDLGGYANAKTAYMKQKHRLIWERRHGPVG-SGMKEEA 157
            .|||.|:.||..:|..       :|                 |.:.|.|:. .|.|.||
plant    68 QKCRHLVQQYLDSTRG-------VG-----------------WGKDHRPISLHGPKPEA 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-PDSWNP_651972.1 NDUFB10 20..145 CDD:402040 23/109 (21%)
AT3G18410NP_001118655.1 NDUFB10 <26..>77 CDD:402040 15/50 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4009
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13094
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.