DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-PDSW and ndufb10

DIOPT Version :9

Sequence 1:NP_651972.1 Gene:ND-PDSW / 44228 FlyBaseID:FBgn0021967 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001017250.1 Gene:ndufb10 / 550004 XenbaseID:XB-GENE-5887772 Length:174 Species:Xenopus tropicalis


Alignment Length:160 Identity:56/160 - (35%)
Similarity:87/160 - (54%) Gaps:18/160 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PEPRS-------------PMASFAESVLNVIDGPITWFRESIVEPNQQKQN---WYHQRFRRVPT 50
            |||.|             |....::.....:|.|:|.|.:.:  ..|:.:|   :||:::||||.
 Frog    11 PEPPSRTPAPDKHTALPNPAVIVSKLFYYAVDVPVTQFHDWV--ERQRSRNTYYYYHRQYRRVPD 73

  Fly    51 IDQCYTDDAVCRFEADQQFRRDRMVDNEIVNILRQRFEDCTLYEAPDHMVKCRPLMDQYEKATEN 115
            :.:|...|.:|.|||:.|::||..||.|||.||::|...|...|...::..|...:.|:.:|.:.
 Frog    74 LTECEVGDYLCYFEAEMQWKRDHKVDQEIVKILQERMRACQQREGHSYVQNCAKEVAQFTEAAKG 138

  Fly   116 WFIKYGDLGGYANAKTAYMKQKHRLIWERR 145
            :..:|||||.|.||:...||||||:|.||:
 Frog   139 YQSRYGDLGAYGNARKCLMKQKHRMIAERK 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-PDSWNP_651972.1 NDUFB10 20..145 CDD:402040 50/127 (39%)
ndufb10NP_001017250.1 NDUFB10 42..168 CDD:370919 50/127 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 105 1.000 Domainoid score I6586
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H3343
Inparanoid 1 1.050 106 1.000 Inparanoid score I4801
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1364322at2759
OrthoFinder 1 1.000 - - FOG0007421
OrthoInspector 1 1.000 - - oto102525
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4136
SonicParanoid 1 1.000 - - X5553
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.