DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-PDSW and NDUFB10

DIOPT Version :9

Sequence 1:NP_651972.1 Gene:ND-PDSW / 44228 FlyBaseID:FBgn0021967 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_004539.1 Gene:NDUFB10 / 4716 HGNCID:7696 Length:172 Species:Homo sapiens


Alignment Length:167 Identity:53/167 - (31%)
Similarity:92/167 - (55%) Gaps:18/167 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PEP-------RSPMASFAESVLNVIDGPITWFRESIVEPNQQKQN---WYHQRFRRVPTIDQCYT 56
            |||       .:|:....::...::|.|:|..||.|  ..|..:|   :||:::||||.|.:|..
Human    11 PEPPRRTPVQPNPIVYMMKAFDLIVDRPVTLVREFI--ERQHAKNRYYYYHRQYRRVPDITECKE 73

  Fly    57 DDAVCRFEADQQFRRDRMVDNEIVNILRQRFEDCTLYEAPDHMVKCRPLMDQYEKATENWFIKYG 121
            :|.:|.:||:.|::||..||.||:||::.|.:.|...|..::...|...::|:.:..:.:..:|.
Human    74 EDIMCMYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQ 138

  Fly   122 DLGGYANAKTAYMKQKHRLIWERRHGPVGSGMKEEAA 158
            |||.|::|:....||:.|::.||:      ..||.||
Human   139 DLGAYSSARKCLAKQRQRMLQERK------AAKEAAA 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-PDSWNP_651972.1 NDUFB10 20..145 CDD:402040 44/127 (35%)
NDUFB10NP_004539.1 NDUFB10 36..161 CDD:287251 43/126 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159726
Domainoid 1 1.000 95 1.000 Domainoid score I7451
eggNOG 1 0.900 - - E1_KOG4009
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3343
Inparanoid 1 1.050 98 1.000 Inparanoid score I5033
Isobase 1 0.950 - 0 Normalized mean entropy S5236
OMA 1 1.010 - - QHG45745
OrthoDB 1 1.010 - - D1364322at2759
OrthoFinder 1 1.000 - - FOG0007421
OrthoInspector 1 1.000 - - oto88650
orthoMCL 1 0.900 - - OOG6_108080
Panther 1 1.100 - - LDO PTHR13094
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4136
SonicParanoid 1 1.000 - - X5553
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.