DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-PDSW and ndufb10

DIOPT Version :9

Sequence 1:NP_651972.1 Gene:ND-PDSW / 44228 FlyBaseID:FBgn0021967 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_957024.1 Gene:ndufb10 / 393703 ZFINID:ZDB-GENE-040426-1691 Length:170 Species:Danio rerio


Alignment Length:157 Identity:57/157 - (36%)
Similarity:90/157 - (57%) Gaps:16/157 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PEP--RSPMASFAESVLN-----------VIDGPITWFRESIVE--PNQQKQNWYHQRFRRVPTI 51
            |||  |:||.:...:|.|           .:|.|::.|| .|||  ...:|..:|||:|||||.:
Zfish    11 PEPPSRTPMENKQTAVPNPAVLITKVFYYTVDLPVSTFR-GIVERFRGDKKAYYYHQKFRRVPEL 74

  Fly    52 DQCYTDDAVCRFEADQQFRRDRMVDNEIVNILRQRFEDCTLYEAPDHMVKCRPLMDQYEKATENW 116
            .||...|.:|.:||:.|:|||..||.|||.:::.|.:.|...|...::..|:..:.|:::.::.:
Zfish    75 TQCQQGDFLCYYEAEMQWRRDYKVDQEIVKVMQNRLKACQQREGHSYVQNCQKEIKQFKETSQAF 139

  Fly   117 FIKYGDLGGYANAKTAYMKQKHRLIWE 143
            ..:|||||.|.:|:...||||.|::.|
Zfish   140 QSRYGDLGAYGSARKCLMKQKERMMKE 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-PDSWNP_651972.1 NDUFB10 20..145 CDD:402040 49/126 (39%)
ndufb10NP_957024.1 NDUFB10 42..166 CDD:287251 48/124 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595946
Domainoid 1 1.000 97 1.000 Domainoid score I7231
eggNOG 1 0.900 - - E1_KOG4009
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3343
Inparanoid 1 1.050 101 1.000 Inparanoid score I4986
OMA 1 1.010 - - QHG45745
OrthoDB 1 1.010 - - D1364322at2759
OrthoFinder 1 1.000 - - FOG0007421
OrthoInspector 1 1.000 - - oto40955
orthoMCL 1 0.900 - - OOG6_108080
Panther 1 1.100 - - LDO PTHR13094
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4136
SonicParanoid 1 1.000 - - X5553
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.