DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-PDSW and F59C6.5

DIOPT Version :9

Sequence 1:NP_651972.1 Gene:ND-PDSW / 44228 FlyBaseID:FBgn0021967 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_492752.1 Gene:F59C6.5 / 172933 WormBaseID:WBGene00010326 Length:260 Species:Caenorhabditis elegans


Alignment Length:141 Identity:68/141 - (48%)
Similarity:96/141 - (68%) Gaps:6/141 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DGPITWFRESIVEP--NQQKQNWYHQRFRRVPTIDQCYTDDAVCRFEADQQFRRDRMVDNEIVNI 82
            |.|.|||||:||:|  |:.:..:||::..|||.||:|..:|..|.:||::|:|.|:|||..|:..
 Worm    45 DAPATWFRETIVQPLNNKNRLPYYHRQLTRVPEIDECGVNDKACFYEANEQYRLDKMVDGFILQT 109

  Fly    83 LRQRFEDCTLYEAPDHMVKCRPLMDQYEKATENWFIKYGDLGGYANAKTAYMKQKHRLIWERRHG 147
            ||||.:.|.||..|||. .|..:::..|:...|:|:|||:|||.::.:.||||||||:||||||.
 Worm   110 LRQRVDRCMLYNNPDHS-PCAKVIEDMEENELNFFMKYGELGGESDVRDAYMKQKHRMIWERRHP 173

  Fly   148 PVGSGMKEEAA 158
            .:   |.|.||
 Worm   174 EI---MDERAA 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-PDSWNP_651972.1 NDUFB10 20..145 CDD:402040 61/126 (48%)
F59C6.5NP_492752.1 NDUFB10 45..171 CDD:287251 61/126 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167268
Domainoid 1 1.000 138 1.000 Domainoid score I3000
eggNOG 1 0.900 - - E1_KOG4009
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3343
Inparanoid 1 1.050 142 1.000 Inparanoid score I3058
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007421
OrthoInspector 1 1.000 - - oto19941
orthoMCL 1 0.900 - - OOG6_108080
Panther 1 1.100 - - LDO PTHR13094
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4136
SonicParanoid 1 1.000 - - X5553
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.820

Return to query results.
Submit another query.