DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Xbp1 and bZIP44

DIOPT Version :9

Sequence 1:NP_726032.4 Gene:Xbp1 / 44226 FlyBaseID:FBgn0021872 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_177672.2 Gene:bZIP44 / 843875 AraportID:AT1G75390 Length:173 Species:Arabidopsis thaliana


Alignment Length:151 Identity:32/151 - (21%)
Similarity:71/151 - (47%) Gaps:20/151 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 SSSGYASSSNMDDDNMAASQPKAKKRRLDHLTWEEKVQRKKLKNRVAAQTSRDRKKARMEEMDYE 112
            |:||..||  :....:|.|..::..|:.|.:  :|:.:::|..||.:|:.||.||:..::::..:
plant    10 STSGNCSS--VSTTGLANSGSESDLRQRDLI--DERKRKRKQSNRESARRSRMRKQKHLDDLTAQ 70

  Fly   113 IKELTDRTEILQNKCDSLQAINESLLAKNH--KLDSELELLRQELAELKQQQQHNTRCISQSNAS 175
            :..|         :.::.|.:....:...|  .:::|.::||.::.||..:.|.....:....:|
plant    71 VTHL---------RKENAQIVAGIAVTTQHYVTIEAENDILRAQVLELNHRLQSLNEIVDFVESS 126

  Fly   176 AGAEGCASTNLGSAAGYTTGG 196
            :...|     :.:..|...||
plant   127 SSGFG-----METGQGLFDGG 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Xbp1NP_726032.4 bZIP_XBP1 81..138 CDD:269839 11/56 (20%)
coiled coil 84..135 CDD:269839 10/50 (20%)
Prefoldin <114..167 CDD:298833 9/54 (17%)
bZIP44NP_177672.2 bZIP_plant_GBF1 42..92 CDD:269850 10/58 (17%)
coiled coil 42..92 CDD:269850 10/58 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.