DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Xbp1 and bZIP58

DIOPT Version :9

Sequence 1:NP_726032.4 Gene:Xbp1 / 44226 FlyBaseID:FBgn0021872 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_172817.2 Gene:bZIP58 / 837921 AraportID:AT1G13600 Length:196 Species:Arabidopsis thaliana


Alignment Length:156 Identity:41/156 - (26%)
Similarity:72/156 - (46%) Gaps:19/156 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 ASPTPSSS-----------GYASSSNMDDDNMAASQPKAKKRRLDHLTWEEKVQRKKLKNRVAAQ 96
            :|||..||           .|:|||| ..|.|.::...:.:.....:..:|:.||:.:.||.:|:
plant    36 SSPTSCSSFYHLNGLINNNNYSSSSN-GQDLMTSNNSTSDEDHQQSMVIDERKQRRMISNRESAR 99

  Fly    97 TSRDRKKARMEEMDYEIKELTDRTEILQNKCDSLQAINESLLAKNHKLDSELELLRQELAELKQQ 161
            .||.||:..::|:..::..|......|.:|.:.:...:|..|.:|.||..|...|||.::|:|..
plant   100 RSRMRKQRHLDELWSQVIRLRTDNHCLMDKLNRVSESHELALKENAKLKEETSDLRQLISEIKSH 164

  Fly   162 QQHNTR-------CISQSNASAGAEG 180
            .:.:..       .||.|.:.:...|
plant   165 NEDDNSFLRELEDSISNSRSDSNQSG 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Xbp1NP_726032.4 bZIP_XBP1 81..138 CDD:269839 15/56 (27%)
coiled coil 84..135 CDD:269839 13/50 (26%)
Prefoldin <114..167 CDD:298833 14/52 (27%)
bZIP58NP_172817.2 Smc <75..>179 CDD:224117 25/103 (24%)
bZIP_plant_GBF1 87..137 CDD:269850 13/49 (27%)
coiled coil 87..137 CDD:269850 13/49 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.