DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Xbp1 and AT2G21230

DIOPT Version :9

Sequence 1:NP_726032.4 Gene:Xbp1 / 44226 FlyBaseID:FBgn0021872 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001318259.1 Gene:AT2G21230 / 816660 AraportID:AT2G21230 Length:525 Species:Arabidopsis thaliana


Alignment Length:173 Identity:42/173 - (24%)
Similarity:77/173 - (44%) Gaps:22/173 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LKVSATPSASPTPSSSGYASSSNMDDDNMAASQPKAKKRRLDH-----LTWEEKVQRKKLKNRVA 94
            |..|::...|||.|..|.:|:.:::..|...:..:.||...|.     :..:.|..::.|.|||:
plant   319 LPPSSSAKVSPTNSGEGNSSAYSVEFGNSEFTAAEMKKIAADEKLAEIVMADPKRVKRILANRVS 383

  Fly    95 AQTSRDRKKARMEEMDYEIKELTDRTEILQNKCDSLQAINESLLAKNHKLDSELELLRQE----- 154
            |..|::||...|.|::::::.|......|..:...||..:..|..:|.:|...|:.:.|:     
plant   384 AARSKERKTRYMAELEHKVQTLQTEATTLSAQLTHLQRDSMGLTNQNSELKFRLQAMEQQAQLRD 448

  Fly   155 -------LAE-LKQQQQHNTRCISQSN----ASAGAEGCASTN 185
                   |:| |.::.|.....|.:.|    .|:.:|...|.|
plant   449 GMHIIKTLSEKLNEEVQRLKLVIGEPNRRQSGSSSSESKMSLN 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Xbp1NP_726032.4 bZIP_XBP1 81..138 CDD:269839 15/56 (27%)
coiled coil 84..135 CDD:269839 14/50 (28%)
Prefoldin <114..167 CDD:298833 13/65 (20%)
AT2G21230NP_001318259.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.