DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Xbp1 and xbp1

DIOPT Version :9

Sequence 1:NP_726032.4 Gene:Xbp1 / 44226 FlyBaseID:FBgn0021872 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_571949.1 Gene:xbp1 / 140614 ZFINID:ZDB-GENE-011210-2 Length:263 Species:Danio rerio


Alignment Length:165 Identity:62/165 - (37%)
Similarity:86/165 - (52%) Gaps:19/165 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LLKVSATPSASPTPSSSGYASS--------SNMDDDNMAASQPKAKKRRLDHLTWEEKVQRKKLK 90
            :|.:|...|||...:..||:.|        ::.|.|:..:..|..|::||.||:.|||..|:|||
Zfish    14 VLLISGKQSASTGATQGGYSRSISVMIPNQASSDSDSTTSGPPLRKRQRLTHLSPEEKALRRKLK 78

  Fly    91 NRVAAQTSRDRKKARMEEMDYEIKELTDRTEILQNKCDSLQAINESLLAKNHKLDSELELLRQEL 155
            |||||||:||||||:|.|::.::.||.     |:|:  .|...|..|..|...|.||.|.|||.|
Zfish    79 NRVAAQTARDRKKAKMGELEQQVLELE-----LENQ--KLHVENRLLRDKTSDLLSENEELRQRL 136

  Fly   156 A----ELKQQQQHNTRCISQSNASAGAEGCASTNL 186
            .    |.|:|.|.....:|......|:...|:..|
Zfish   137 GLDTLETKEQVQVLESAVSDLGLVTGSSESAALRL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Xbp1NP_726032.4 bZIP_XBP1 81..138 CDD:269839 28/56 (50%)
coiled coil 84..135 CDD:269839 24/50 (48%)
Prefoldin <114..167 CDD:298833 20/56 (36%)
xbp1NP_571949.1 bZIP_XBP1 69..126 CDD:269839 30/63 (48%)
coiled coil 72..123 CDD:269839 27/57 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I11504
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005024
OrthoInspector 1 1.000 - - oto40723
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR46542
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3215
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
66.040

Return to query results.
Submit another query.