DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sr-CII and Mdga1

DIOPT Version :10

Sequence 1:NP_524720.2 Gene:Sr-CII / 44219 FlyBaseID:FBgn0020377 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001401873.1 Gene:Mdga1 / 309659 RGDID:1307031 Length:956 Species:Rattus norvegicus


Alignment Length:182 Identity:57/182 - (31%)
Similarity:82/182 - (45%) Gaps:19/182 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 DHSCDFESEDQCGWSAEETIWLPWKRISAVTD--FHHPRTGPRYDHTFGNTSGGHYMRMETQ--I 193
            |::|.||.|..||::.:.|....|.|.:|:|.  ...|.|||..|  ...|..|:||.:||.  .
  Rat   751 DNTCHFEDEKICGYTQDLTDNFDWTRQNALTQNPKRSPNTGPPTD--ISGTPEGYYMFIETSRPR 813

  Fly   194 EAYGSYHFVSPVYPRSLCLNVACCFRFHYFMFGAGVDRLVLSVKPASLQIDDMWNSFRSNSSKFE 258
            |.......|||:|..|...   .|..|.|.|:|..:..|.|.|:..        |....::..:.
  Rat   814 ELGDRARLVSPLYNASAKF---YCVSFFYHMYGKHIGSLNLLVRSR--------NKGTLDTHAWS 867

  Fly   259 ITGSQGTHWLENTITIDKMHEDFQVVFTATDARSQFGDIAIDDVKLMTGSEC 310
            ::|::|..|.:..:.|:. ...||::|.........||||||||.|..| ||
  Rat   868 LSGNKGNVWQQAHVPINP-SGPFQIIFEGVRGSGYLGDIAIDDVTLKKG-EC 917

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sr-CIINP_524720.2 PHA02927 <22..127 CDD:222943
Sushi 27..72 CDD:459664
MAM 136..311 CDD:459878 56/179 (31%)
Somatomedin_B 340..388 CDD:460034
Mdga1NP_001401873.1 Ig 54..115 CDD:472250
Ig strand B 56..60 CDD:409353
Ig strand C 69..73 CDD:409353
Ig strand E 91..95 CDD:409353
Ig strand F 105..110 CDD:409353
Ig_3 132..217 CDD:464046
IG_like 248..326 CDD:214653
Ig strand B 258..262 CDD:409353
Ig strand C 272..276 CDD:409353
Ig strand E 291..295 CDD:409353
Ig strand F 305..310 CDD:409353
Ig strand G 319..322 CDD:409353
Ig 347..418 CDD:472250
Ig strand B 353..357 CDD:409353
Ig strand C 368..372 CDD:409353
Ig strand E 398..402 CDD:409353
Ig strand F 412..417 CDD:409353
Ig_3 439..515 CDD:464046
Ig_3 538..620 CDD:464046
MAM 754..917 CDD:99706 54/177 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 780..799 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.