DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-23 and ndhI

DIOPT Version :9

Sequence 1:NP_524719.1 Gene:ND-23 / 44207 FlyBaseID:FBgn0017567 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_051113.1 Gene:ndhI / 844806 -ID:- Length:172 Species:Arabidopsis thaliana


Alignment Length:141 Identity:52/141 - (36%)
Similarity:73/141 - (51%) Gaps:11/141 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 MEFADITDRAASTMFFGELLRGFAVTLAHIFKEPATINYPFEKGPLSPRFRGEHALRRYPSGEER 117
            |.:...|.|||  .:.|:   ||.:||:|..:.|.||.||:||...|.||||     |.....::
plant     9 MNYGQQTLRAA--RYIGQ---GFMITLSHTNRLPVTIQYPYEKLITSERFRG-----RIHFEFDK 63

  Fly   118 CIACKLCEAICPAQAITIEAE-ERADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFS 181
            ||||::|..:||.....::.: |.....:|...|.||...||:||.|.|.||.:.:.....:|||
plant    64 CIACEVCVRVCPIDLPVVDWKLETNIRKKRLLNYSIDFGICIFCGNCVEYCPTNCLSMTEEYEFS 128

  Fly   182 TETHEELLYNK 192
            |....||.||:
plant   129 TYDRHELNYNQ 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-23NP_524719.1 PRK05888 61..217 CDD:235637 50/133 (38%)
ndhINP_051113.1 ndhI 4..169 CDD:214334 52/141 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1283957at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100887
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.