DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-23 and AT1G79010

DIOPT Version :9

Sequence 1:NP_524719.1 Gene:ND-23 / 44207 FlyBaseID:FBgn0017567 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_178022.1 Gene:AT1G79010 / 844242 AraportID:AT1G79010 Length:222 Species:Arabidopsis thaliana


Alignment Length:224 Identity:142/224 - (63%)
Similarity:170/224 - (75%) Gaps:23/224 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TMRIFTASRNGQRLFGSHGARLLAAQRAEPKDIVEVPKGYVYVNN----------KELSMEFADI 58
            |:|......:||.|.|||.:||.:             :|..|.:|          ||:|.::..:
plant    12 TLRARHLVLSGQALQGSHLSRLQS-------------RGISYGSNKDDEEAEQLSKEISKDWNTV 63

  Fly    59 TDRAASTMFFGELLRGFAVTLAHIFKEPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKL 123
            .:|:.:|:|..|::||.::||.:.|....|||||||||||||||||||||||||:||||||||||
plant    64 FERSINTLFLTEMVRGLSLTLKYFFDPKVTINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKL 128

  Fly   124 CEAICPAQAITIEAEERADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEEL 188
            |||:|||||||||||||.|||||||||||||||||||||||||||||||||||||||:|||||||
plant   129 CEAVCPAQAITIEAEEREDGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFATETHEEL 193

  Fly   189 LYNKEKLLCNGDKWESEIASNLQADHLYR 217
            ||:|||||.|||:||:|||.||:::.|||
plant   194 LYDKEKLLENGDRWETEIAENLRSESLYR 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-23NP_524719.1 PRK05888 61..217 CDD:235637 124/155 (80%)
AT1G79010NP_178022.1 PRK05888 64..222 CDD:235637 124/157 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 120 1.000 Domainoid score I1886
eggNOG 1 0.900 - - E1_COG1143
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1867
Inparanoid 1 1.050 288 1.000 Inparanoid score I842
OMA 1 1.010 - - QHG55295
OrthoDB 1 1.010 - - D1283957at2759
OrthoFinder 1 1.000 - - FOG0004083
OrthoInspector 1 1.000 - - otm3271
orthoMCL 1 0.900 - - OOG6_100887
Panther 1 1.100 - - LDO PTHR10849
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2833
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.