DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-23 and AT1G16700

DIOPT Version :9

Sequence 1:NP_524719.1 Gene:ND-23 / 44207 FlyBaseID:FBgn0017567 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_173114.1 Gene:AT1G16700 / 838239 AraportID:AT1G16700 Length:222 Species:Arabidopsis thaliana


Alignment Length:223 Identity:145/223 - (65%)
Similarity:172/223 - (77%) Gaps:13/223 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LTMRIFTASR------NGQRLFGSH--GARLLAAQRAEPKDIVEVPKGYVYVNNKELSMEFADIT 59
            |..|.|:|.|      :||.|.|||  |.:..|......||..|..:     ..||:|.:::.:.
plant     5 LARRSFSALRARHLAFSGQGLQGSHLCGLQSRAISYGSNKDDEEAEQ-----LAKEISKDWSTVF 64

  Fly    60 DRAASTMFFGELLRGFAVTLAHIFKEPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLC 124
            :|:.:|:|..|::||.::||.:.|....|||||||||||||||||||||||||:|||||||||||
plant    65 ERSMNTLFLTEMVRGLSLTLKYFFDPKVTINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLC 129

  Fly   125 EAICPAQAITIEAEERADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELL 189
            ||:|||||||||||||.|||||||||||||||||||||||||||||||||||||||:||||||||
plant   130 EAVCPAQAITIEAEEREDGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFATETHEELL 194

  Fly   190 YNKEKLLCNGDKWESEIASNLQADHLYR 217
            |:|||||.|||:||:|||.||:::.|||
plant   195 YDKEKLLENGDRWETEIAENLRSESLYR 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-23NP_524719.1 PRK05888 61..217 CDD:235637 124/155 (80%)
AT1G16700NP_173114.1 PRK05888 64..222 CDD:235637 124/157 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 120 1.000 Domainoid score I1886
eggNOG 1 0.900 - - E1_COG1143
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1867
Inparanoid 1 1.050 288 1.000 Inparanoid score I842
OMA 1 1.010 - - QHG55295
OrthoDB 1 1.010 - - D1283957at2759
OrthoFinder 1 1.000 - - FOG0004083
OrthoInspector 1 1.000 - - otm3271
orthoMCL 1 0.900 - - OOG6_100887
Panther 1 1.100 - - LDO PTHR10849
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2833
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.