DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-23 and ndufs8b

DIOPT Version :9

Sequence 1:NP_524719.1 Gene:ND-23 / 44207 FlyBaseID:FBgn0017567 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001019573.2 Gene:ndufs8b / 554100 ZFINID:ZDB-GENE-050522-131 Length:212 Species:Danio rerio


Alignment Length:218 Identity:153/218 - (70%)
Similarity:176/218 - (80%) Gaps:9/218 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLTMRI-FTASRNGQRLFGSHGARLLAAQRAEPKDIVEVPKGYVYVNNKELSMEFADITDRAAS 64
            |.:|:|| |::.|.     |:..|||   ....|..:.....||.|||.::|..:...||||||.
Zfish     3 MEMTLRILFSSCRT-----GTFAARL---GPVRPFSLTIHRGGYKYVNAEDLPSDLKSITDRAAQ 59

  Fly    65 TMFFGELLRGFAVTLAHIFKEPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICP 129
            |:...||.||.|:.::::|:||||||||||||||||||||||||||||:|||||||||||||:||
Zfish    60 TLLLTELCRGLAMAVSYLFREPATINYPFEKGPLSPRFRGEHALRRYPNGEERCIACKLCEAVCP 124

  Fly   130 AQAITIEAEERADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEK 194
            |||||||||.||||||||||||||||||||||||||||||||||||||||:||||||||||||||
Zfish   125 AQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYNKEK 189

  Fly   195 LLCNGDKWESEIASNLQADHLYR 217
            ||.|||:||.|||:|:|||:|||
Zfish   190 LLNNGDRWEVEIAANIQADYLYR 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-23NP_524719.1 PRK05888 61..217 CDD:235637 131/155 (85%)
ndufs8bNP_001019573.2 PRK05888 56..212 CDD:235637 131/155 (85%)
Fer4_9 113..163 CDD:289930 47/49 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 115 1.000 Domainoid score I5978
eggNOG 1 0.900 - - E1_COG1143
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1867
Inparanoid 1 1.050 315 1.000 Inparanoid score I2536
OMA 1 1.010 - - QHG55295
OrthoDB 1 1.010 - - D1283957at2759
OrthoFinder 1 1.000 - - FOG0004083
OrthoInspector 1 1.000 - - otm26329
orthoMCL 1 0.900 - - OOG6_100887
Panther 1 1.100 - - O PTHR10849
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2833
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.880

Return to query results.
Submit another query.