DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-23 and NDUFS8

DIOPT Version :9

Sequence 1:NP_524719.1 Gene:ND-23 / 44207 FlyBaseID:FBgn0017567 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_002487.1 Gene:NDUFS8 / 4728 HGNCID:7715 Length:210 Species:Homo sapiens


Alignment Length:204 Identity:152/204 - (74%)
Similarity:167/204 - (81%) Gaps:17/204 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LLAAQRAEPKDIVEVPKG-----------YVYVNNKELSMEFADITDRAASTMFFGELLRGFAVT 78
            |..|.||.|      |.|           |.|||.::..|:...:|||||.|:.:.||.||..:|
Human    13 LAQAARAGP------PGGRSLHSSAVAATYKYVNMQDPEMDMKSVTDRAARTLLWTELFRGLGMT 71

  Fly    79 LAHIFKEPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEERADG 143
            |:::|:||||||||||||||||||||||||||||||||||||||||||||||||||||||.||||
Human    72 LSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEPRADG 136

  Fly   144 SRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLCNGDKWESEIAS 208
            |||||||||||||||||||||||||||||||||||||||||||||||||||||.||||||:|||:
Human   137 SRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLNNGDKWEAEIAA 201

  Fly   209 NLQADHLYR 217
            |:|||:|||
Human   202 NIQADYLYR 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-23NP_524719.1 PRK05888 61..217 CDD:235637 136/155 (88%)
NDUFS8NP_002487.1 PRK05888 54..210 CDD:235637 136/155 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147914
Domainoid 1 1.000 120 1.000 Domainoid score I5784
eggNOG 1 0.900 - - E1_COG1143
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1867
Inparanoid 1 1.050 312 1.000 Inparanoid score I2592
Isobase 1 0.950 - 0 Normalized mean entropy S2075
OMA 1 1.010 - - QHG55295
OrthoDB 1 1.010 - - D1283957at2759
OrthoFinder 1 1.000 - - FOG0004083
OrthoInspector 1 1.000 - - oto90078
orthoMCL 1 0.900 - - OOG6_100887
Panther 1 1.100 - - LDO PTHR10849
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2670
SonicParanoid 1 1.000 - - X2833
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.