DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-23 and ndufs8

DIOPT Version :9

Sequence 1:NP_524719.1 Gene:ND-23 / 44207 FlyBaseID:FBgn0017567 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001006930.1 Gene:ndufs8 / 448777 XenbaseID:XB-GENE-945877 Length:209 Species:Xenopus tropicalis


Alignment Length:187 Identity:143/187 - (76%)
Similarity:159/187 - (85%) Gaps:0/187 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 AEPKDIVEVPKGYVYVNNKELSMEFADITDRAASTMFFGELLRGFAVTLAHIFKEPATINYPFEK 95
            :.|..:......|.|||.:|.:.:...:|||||.|:.:.||.||..:||:::|:|||||||||||
 Frog    23 SRPLSLASQMHSYKYVNAREEATDLKSVTDRAAQTLLWTELFRGLGMTLSYLFREPATINYPFEK 87

  Fly    96 GPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEERADGSRRTTRYDIDMTKCIYC 160
            |||||||||||||||||||||||||||||||:|||||||||||.|.|||||||||||||||||||
 Frog    88 GPLSPRFRGEHALRRYPSGEERCIACKLCEAVCPAQAITIEAEPRTDGSRRTTRYDIDMTKCIYC 152

  Fly   161 GFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLCNGDKWESEIASNLQADHLYR 217
            ||||||||||||||||||||||||||||||||||||.||||||.||.:|:|||.|||
 Frog   153 GFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLNNGDKWEVEIGANIQADFLYR 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-23NP_524719.1 PRK05888 61..217 CDD:235637 133/155 (86%)
ndufs8NP_001006930.1 PRK05888 53..209 CDD:235637 133/155 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 118 1.000 Domainoid score I5820
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1867
Inparanoid 1 1.050 304 1.000 Inparanoid score I2619
OMA 1 1.010 - - QHG55295
OrthoDB 1 1.010 - - D1283957at2759
OrthoFinder 1 1.000 - - FOG0004083
OrthoInspector 1 1.000 - - oto103887
Panther 1 1.100 - - LDO PTHR10849
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2670
SonicParanoid 1 1.000 - - X2833
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1313.110

Return to query results.
Submit another query.