DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spen and SR34a

DIOPT Version :9

Sequence 1:NP_722615.1 Gene:spen / 44205 FlyBaseID:FBgn0016977 Length:5560 Species:Drosophila melanogaster
Sequence 2:NP_001190041.1 Gene:SR34a / 824105 AraportID:AT3G49430 Length:300 Species:Arabidopsis thaliana


Alignment Length:345 Identity:67/345 - (19%)
Similarity:119/345 - (34%) Gaps:119/345 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   655 TRTLFIGNLEKDITAGELRSHFEAFGEIIEIDIK-KQGLNAYAFCQYSDIVSVVKAMRKMDGEHL 718
            :|::::|||..||...|:...|..:|.|::|::| ......|.|.::........|::..||.:|
plant     6 SRSIYVGNLPGDIREHEIEDIFYKYGRIVDIELKVPPRPPCYCFVEFEHSRDAEDAIKGRDGYNL 70

  Fly   719 GSNRIKL-----------------------GFG-----------------------KSMPTNCVW 737
            ...|:::                       |:|                       :.:|::..|
plant    71 DGCRLRVELAHGGRGQSSSDRRGGYGGGGSGYGGGGGGGGSARFGVSRHSEFRVIVRGLPSSASW 135

  Fly   738 IDGVDEKVSESFLQSQFTRFGAV--TKVSIDRNRQLALVLYDQVQNAQAAVKDMRGTILRRKKLQ 800
            .|          |:....:.|.|  .:|:.|.:....:|.|....:.:.|::.:..|..|     
plant   136 QD----------LKDHMRKAGDVCFAEVTRDSDGTYGVVDYTNYDDMKYAIRKLDDTEFR----- 185

  Fly   801 VDFASRECQDAFYDKQEKQQQQSSGSNP------RFSRYESSASSLQSRSRASSFSRHQNNSNDD 859
                                      ||      |..:||||.|..:|.||:.|.||.::.|.  
plant   186 --------------------------NPWARGFIRVKKYESSRSRSRSPSRSRSRSRSRSRSR-- 222

  Fly   860 CSPINTPGGASSGISSASNLINQSTSINISNIGTNACSAMPAPSLASAVVSCNVNASGTVPASTS 924
                      ..|.|.     ::|.|::.|.......|..|..||:.::   :.:.|.:.....|
plant   223 ----------GRGRSH-----SRSRSLSRSKSPRKDLSKSPRRSLSRSI---SKSRSPSPDKKKS 269

  Fly   925 MPSGVSSSSS---SLPMSPA 941
            .|..:|.|.|   |...||:
plant   270 PPRAMSRSKSRSRSRSRSPS 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spenNP_722615.1 RRM2_SHARP 555..628 CDD:240795
RRM3_SHARP 654..726 CDD:240796 19/94 (20%)
RRM4_SHARP 727..803 CDD:240797 14/100 (14%)
RILP-like 1997..>2055 CDD:304877
SPOC 5404..5527 CDD:285043
SR34aNP_001190041.1 RRM_SF 9..79 CDD:418427 18/69 (26%)
RRM2_SF2_plant_like 122..197 CDD:410014 16/115 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.