DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spen and RS31a

DIOPT Version :9

Sequence 1:NP_722615.1 Gene:spen / 44205 FlyBaseID:FBgn0016977 Length:5560 Species:Drosophila melanogaster
Sequence 2:NP_182184.1 Gene:RS31a / 819273 AraportID:AT2G46610 Length:250 Species:Arabidopsis thaliana


Alignment Length:256 Identity:59/256 - (23%)
Similarity:103/256 - (40%) Gaps:50/256 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   656 RTLFIGNLEKDITAGELRSHFEAFGEIIEIDIKKQGLNAYAFCQYSDIVSVVKAMRKMDGEHLGS 720
            |.:::||.:.|....:|...|..||.:..:|:|    :.|||..:.|......|:|:.|....|.
plant     2 RHVYVGNFDYDTRHSDLERLFSKFGRVKRVDMK----SGYAFVYFEDERDAEDAIRRTDNTTFGY 62

  Fly   721 NRIKLGF---------------GKSM----PTNCVWIDGVDE-KVSESFLQSQFTRFGAVTKVSI 765
            .|.||..               ||::    ||..:::...|. :..|..::..|..:|.|..|.:
plant    63 GRRKLSVEWAKDFQGERGKPRDGKAVSNQRPTKTLFVINFDPIRTRERDMERHFEPYGKVLNVRM 127

  Fly   766 DRNRQLALVLYDQVQNAQAAVKDMRGTILRRKKLQVDFASRECQDAFYDKQEKQQQQSSGS---- 826
            .||  .|.|.:...::|..|:.....:.|..|.:.|::|.||..:. .|:....:::.|.|    
plant   128 RRN--FAFVQFATQEDATKALDSTHNSKLLDKVVSVEYALREAGER-EDRYAGSRRRRSPSPVYR 189

  Fly   827 -----------NPRFSRYESSASSLQSRS-----RASSFSRHQNNS---NDDCSPINTPGG 868
                       :|.:.||:..|...:.:|     |:|.:.|.:..|   :...|||....|
plant   190 RRPSPDYTRRRSPEYDRYKGPAPYERRKSPDYGRRSSDYGRARARSPGYDRSRSPIQRARG 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spenNP_722615.1 RRM2_SHARP 555..628 CDD:240795
RRM3_SHARP 654..726 CDD:240796 20/69 (29%)
RRM4_SHARP 727..803 CDD:240797 19/95 (20%)
RILP-like 1997..>2055 CDD:304877
SPOC 5404..5527 CDD:285043
RS31aNP_182184.1 RRM_SF 2..73 CDD:302621 21/74 (28%)
RRM_SF 96..165 CDD:302621 15/70 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.