DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spen and grld-1

DIOPT Version :9

Sequence 1:NP_722615.1 Gene:spen / 44205 FlyBaseID:FBgn0016977 Length:5560 Species:Drosophila melanogaster
Sequence 2:NP_741283.1 Gene:grld-1 / 176827 WormBaseID:WBGene00017929 Length:520 Species:Caenorhabditis elegans


Alignment Length:361 Identity:86/361 - (23%)
Similarity:144/361 - (39%) Gaps:74/361 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   554 LAIRVRNLPARSSDTSLKDGLFHEYKKHGKVTWVKVV--GQNSERYALVCFKKPDDVEKALEVSH 616
            |.:|:.....|.....:|..|..|.||:.... :|||  .:..||.|.|.|::.|...|......
 Worm    34 LNLRISGFDDRLEREQIKQYLTQELKKYAPFE-IKVVKNPEEDERLAYVNFERNDCARKVRYTLM 97

  Fly   617 D--KHFFGCKIEVEP------YQGYDVED--------------------NEFRPYEA----ELDE 649
            |  |...|.:::.:|      .:|..:.|                    |..||.:.    .|.:
 Worm    98 DRLKSVLGKRVQCDPAGILRDQEGKYIPDRFNRAQHGADSKREGGSGSGNRGRPTKEPSTWRLKQ 162

  Fly   650 YHPKSTRTLFIGNLEKDITAGELRSHFEAFGEIIEIDIKKQGLN---AYAFCQYSDIVSVVKAMR 711
            ...::|||||:||:..|:...|:|..||..|::.|:|||.. :|   ||||..:..:...::|..
 Worm   163 DDDEATRTLFVGNMPSDVKEREIRHVFEEHGKVEEVDIKTP-INTDAAYAFVMFQTVDQAIQAKA 226

  Fly   712 KMDGEHL--GSNRIKLGFGKSMPTNCVWIDGVDEKVSESFLQSQFTRFGAVTKVSIDRNRQLALV 774
            :.....:  |.:|:|:|:|||..:..:::.|:.....:..||..|..||.|..:..|..:..|.|
 Worm   227 EEQDRPIRAGGSRMKIGYGKSQVSRRLFVGGLGSWCDKEILQKAFGEFGFVENIDYDHGQPYAYV 291

  Fly   775 LYDQVQNAQAAVKDMRGTILRRKKLQVDFASRECQDAFYDKQEKQQQQSSGSNPRFSRYESSASS 839
            :|:....:|.|.:.:||..:                            |.|::|....|   |..
 Worm   292 VYENTHTSQEACRSLRGACI----------------------------SKGNHPIMVDY---AKD 325

  Fly   840 LQSRSRASSFSRHQNNSND--DCSPINTPGGASSGI 873
            |.::.....|.|.:..|..  ..|.:.||.|:...:
 Worm   326 LTAQPEKQQFMRKRRASKSPVGASAVRTPPGSPKDV 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spenNP_722615.1 RRM2_SHARP 555..628 CDD:240795 20/76 (26%)
RRM3_SHARP 654..726 CDD:240796 26/76 (34%)
RRM4_SHARP 727..803 CDD:240797 18/75 (24%)
RILP-like 1997..>2055 CDD:304877
SPOC 5404..5527 CDD:285043
grld-1NP_741283.1 RRM_SF 33..>93 CDD:302621 18/59 (31%)
RRM_SF 167..246 CDD:302621 27/79 (34%)
RRM3_Spen 253..324 CDD:240756 19/101 (19%)
SPOC 376..482 CDD:285043
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D367857at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.