DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ScpX and SCP2

DIOPT Version :10

Sequence 1:NP_524715.2 Gene:ScpX / 44183 FlyBaseID:FBgn0015808 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_199103.1 Gene:SCP2 / 834300 AraportID:AT5G42890 Length:123 Species:Arabidopsis thaliana


Alignment Length:107 Identity:35/107 - (32%)
Similarity:61/107 - (57%) Gaps:14/107 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   427 LLKLLEQAMQEDK-DNLIEKVRAIYGFKVNNGPNGQTGF----WVIDAKQG---KGKIIFNGTQK 483
            ::.::::.:..|. ..:.||:..:|  ::|..|. :.||    :::|.|:|   |||  :.| .|
plant    11 IMDMMKEHLSTDAGKEVTEKIGLVY--QINIAPK-KLGFEEVTYIVDLKKGEVTKGK--YEG-GK 69

  Fly   484 CDVTFIISDDDVFELLTGKLPPQKAFFQGKIKIQGNMGFAMK 525
            .|.||...|||..::.|||:.||.||.:|.:||:|::..|.|
plant    70 VDATFSFKDDDFVKVATGKMNPQMAFIRGAMKIKGSLSAAQK 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScpXNP_524715.2 PRK08256 5..396 CDD:181327
SCP2 428..531 CDD:460423 35/106 (33%)
SCP2NP_199103.1 SCP2 32..112 CDD:460423 32/86 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.