DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ScpX and NYC1

DIOPT Version :9

Sequence 1:NP_524715.2 Gene:ScpX / 44183 FlyBaseID:FBgn0015808 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_567400.1 Gene:NYC1 / 826942 AraportID:AT4G13250 Length:496 Species:Arabidopsis thaliana


Alignment Length:361 Identity:78/361 - (21%)
Similarity:121/361 - (33%) Gaps:127/361 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 TLEQIMKSPQVVEGVL---------TKLQCCPTSDGSGAAILASEAFVRRHGLEKQAVEIVGMEM 251
            ||.:|...|||:|..|         ::|.|...|         :..:|  |..||:......:|.
plant     3 TLTKIQVYPQVLEHRLFFRDPIRVGSRLTCRERS---------NRVYV--HRCEKKVERKRKVEK 56

  Fly   252 ASDPASTFADKSLMKIAGTDMTRLATQRLFAKSGYKPQD---VQVVELHDCFS------ANELIT 307
            .....|..:.||  ...|           |:|.|:..:|   .:|..|...||      |..::|
plant    57 FKGNGSWDSLKS--GFLG-----------FSKLGFLSKDEYNQKVENLEMVFSSVAVQIARYIVT 108

  Fly   308 YEALG---LCGEGNAGEFIDAGDNTYGGKFVVNPSGGLISKGHPLGA-TGLAQCAELCWQLRGLA 368
            ..:.|   |.|...:|     ||::.......:..||:|     :|. ||               
plant   109 MTSTGAILLIGFQLSG-----GDSSMNSLVWYSWLGGII-----IGTMTG--------------- 148

  Fly   369 EKRQVPNAQLALQHNLGLGGAVVVALYRLGFPAANSVVRNLT-AAGKA-------------ATSE 419
                   |.:.|:.:           ||.|  ..|.|:...| ..|||             .||.
plant   149 -------ANMVLEDH-----------YRAG--PRNVVITGSTRGLGKALAREFLLSGDRVIVTSR 193

  Fly   420 DGFKVAPLLKLLEQAMQEDKDNLIEKVR------AIYGF-----------KVNN---GPNGQTGF 464
            ....|...:|.|||.::|...|..|..|      .:.|.           |::|   ...|....
plant   194 SSESVDMTVKELEQNLKEIMSNASESARKKLSDAKVVGIACDVCKPEDVEKLSNFAVKELGSINI 258

  Fly   465 WVIDAKQGKG-KIIFNGTQKCDVTFIISDDDVFELL 499
            |:.:|...|| :.:...|:: |:|.|:|.:.:..:|
plant   259 WINNAGTNKGFRPLLEFTEE-DITQIVSTNLIGSIL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScpXNP_524715.2 PRK08256 5..396 CDD:181327 44/221 (20%)
SCP-x_thiolase 9..395 CDD:238425 44/220 (20%)
SCP2 429..529 CDD:280250 22/92 (24%)
NYC1NP_567400.1 SDR_c 164..395 CDD:212491 30/131 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24314
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.