DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ScpX and stoml1

DIOPT Version :9

Sequence 1:NP_524715.2 Gene:ScpX / 44183 FlyBaseID:FBgn0015808 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_001039193.1 Gene:stoml1 / 734047 XenbaseID:XB-GENE-990189 Length:361 Species:Xenopus tropicalis


Alignment Length:171 Identity:45/171 - (26%)
Similarity:76/171 - (44%) Gaps:14/171 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   373 VPNAQLALQHNLGL-GGAVVVALYRLGFPAANSVVRNLTAAGKAATSEDGFKVAPLLK------- 429
            |...:|||:..|.. ..|::|.......|...  :..|.....|.|.:.....:|.||       
 Frog   193 VERVELALESILQ
TPENALIVPSVTPAVPCGG--IDQLLMQFLALTRQSSGNDSPSLKDTDLSLK 255

  Fly   430 -LLEQAMQEDKDNLIEKVRAIYGFKVNNGPNGQTGFWVIDAKQGKGKIIFNGTQKC-DVTFIISD 492
             ||.:......::|:.:|.:.|...|.. |.||...:.:|.|.|.|...: |...| |||..:::
 Frog   256 QLLSKVEASLTESLVSEVGSSYQLYVTM-PGGQISEYFLDLKSGSGNCGW-GVHPCPDVTLEMTE 318

  Fly   493 DDVFELLTGKLPPQKAFFQGKIKIQGNMGFAMKLMDLQRSA 533
            .|:..|:.|.|.|..|:..|::::.||:..|::|..:.|:|
 Frog   319 ADLMSLICGDLHPLTAYTGGRLRVSGNIQTALQLERVLRAA 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScpXNP_524715.2 PRK08256 5..396 CDD:181327 7/23 (30%)
SCP-x_thiolase 9..395 CDD:238425 7/22 (32%)
SCP2 429..529 CDD:280250 30/108 (28%)
stoml1NP_001039193.1 PHB 60..198 CDD:214581 1/4 (25%)
SPFH_SLP-1 75..205 CDD:259814 4/11 (36%)
SCP2 254..357 CDD:280250 29/104 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.