DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ScpX and Hsdl2

DIOPT Version :9

Sequence 1:NP_524715.2 Gene:ScpX / 44183 FlyBaseID:FBgn0015808 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_077217.2 Gene:Hsdl2 / 72479 MGIID:1919729 Length:490 Species:Mus musculus


Alignment Length:118 Identity:39/118 - (33%)
Similarity:66/118 - (55%) Gaps:10/118 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   426 PLLKLLEQAMQEDKDNLIEKV----RAIYGFKVNNGPNGQTGFWVIDAKQGKGKIIFNG--TQKC 484
            |....:|:..:..||:|.::|    :|:|.|:: :|.:|  |.|.:|.|...|| :.:|  :.:.
Mouse   377 PHFGAVEETFRIVKDSLSDEVVRATQAVYQFEL-SGEDG--GTWFLDLKSKGGK-VGHGEPSDRA 437

  Fly   485 DVTFIISDDDVFELLTGKLPPQKAFFQGKIKIQGNMGFAMKLMDLQRSAQGRI 537
            ||...::.||..::.:|||.|..||..||:||:||:..|:||..|......|:
Mouse   438 DVVMSMATDDFVKMFSGKLKPTMAFMSGKLKIKGNIALAIKLEKLMTQMNSRL 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScpXNP_524715.2 PRK08256 5..396 CDD:181327
SCP-x_thiolase 9..395 CDD:238425
SCP2 429..529 CDD:280250 36/105 (34%)
Hsdl2NP_077217.2 HSDL2_SDR_c 8..248 CDD:187663
adh_short 12..197 CDD:278532
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 282..370
SCP2 390..483 CDD:280250 35/96 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4170
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.