DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ScpX and Stoml1

DIOPT Version :9

Sequence 1:NP_524715.2 Gene:ScpX / 44183 FlyBaseID:FBgn0015808 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_081218.3 Gene:Stoml1 / 69106 MGIID:1916356 Length:399 Species:Mus musculus


Alignment Length:174 Identity:44/174 - (25%)
Similarity:78/174 - (44%) Gaps:34/174 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   373 VPNAQLALQHNLGLGGAVVVALYRLGFPAANSVVRNLTAAG------------KAATSEDGFKVA 425
            ||:....||.         :||:.|| .:.||.|.::.:.|            .|:.:..|.:.:
Mouse   232 VPSLDSTLQQ---------LALHLLG-GSMNSAVGHVPSPGPDTLEMINEVEPPASLAGAGPEPS 286

  Fly   426 P-------LLKLLEQAMQEDKDNLIEKVRAIYGFKVNNGPNGQTGFWVIDAKQGKGKIIFNGTQK 483
            |       ||..|:..:.|   .|:.:|.|.|.|.|.. |:|....:.:|...|:|::.......
Mouse   287 PKQPVAEGLLTALQPFLSE---ALVSQVGACYQFNVIL-PSGTQSIYFLDLTTGQGRVGHGEPDG 347

  Fly   484 C-DVTFIISDDDVFELLTGKLPPQKAFFQGKIKIQGNMGFAMKL 526
            . ||...:::.|:..||:.:|.|..|:..|::|::|::...|||
Mouse   348 IPDVVVEMAEADLQALLSKELRPLGAYMSGRLKVKGDLAVVMKL 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScpXNP_524715.2 PRK08256 5..396 CDD:181327 6/22 (27%)
SCP-x_thiolase 9..395 CDD:238425 5/21 (24%)
SCP2 429..529 CDD:280250 27/99 (27%)
Stoml1NP_081218.3 Tyrosine-type lysosomal sorting signal. /evidence=ECO:0000250|UniProtKB:Q9UBI4, ECO:0000255 6..10
PHB 77..217 CDD:214581
SPFH_SLP-1 94..224 CDD:259814
SCP2 305..396 CDD:280250 26/91 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4170
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.