DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ScpX and Scp2d1

DIOPT Version :9

Sequence 1:NP_524715.2 Gene:ScpX / 44183 FlyBaseID:FBgn0015808 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_079766.3 Gene:Scp2d1 / 66328 MGIID:1913578 Length:156 Species:Mus musculus


Alignment Length:165 Identity:49/165 - (29%)
Similarity:74/165 - (44%) Gaps:29/165 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 KRQVPNAQLALQ------HNLGLGGAVVVALYRLGFPAANSVVRNLTAAGKAATSEDGFKVAPLL 428
            ||..|.|::...      .:|.||.|...||     |.|..:              ..|:...:.
Mouse     3 KRPDPQAKIKAGDRPQTCQSLALGSATESAL-----PQALKL--------------SDFQNFSVF 48

  Fly   429 KLLEQAMQEDKDNLIEKVRAIYGFKVNNGPNGQTGF-WVIDAKQGKGKIIFNGTQ-KCDVTFIIS 491
            :.:.|.::|....|::||.||  |:::...:|:|.. |.||.|.|.|.:.....: ..|..|||.
Mouse    49 EDISQHIKEVGAQLVKKVNAI--FQLDITKDGKTILQWTIDLKNGAGDMYLGSARLPADTVFIIP 111

  Fly   492 DDDVFELLTGKLPPQKAFFQGKIKIQGNMGFAMKL 526
            |....||:.||:.|||||..||.|::|.:..:.||
Mouse   112 DSVFTELVVGKINPQKAFLAGKFKVRGKVLLSQKL 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScpXNP_524715.2 PRK08256 5..396 CDD:181327 10/31 (32%)
SCP-x_thiolase 9..395 CDD:238425 9/30 (30%)
SCP2 429..529 CDD:280250 36/100 (36%)
Scp2d1NP_079766.3 SCP2 48..150 CDD:396566 36/101 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831994
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4170
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.