DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ScpX and stoml1

DIOPT Version :9

Sequence 1:NP_524715.2 Gene:ScpX / 44183 FlyBaseID:FBgn0015808 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_001103502.1 Gene:stoml1 / 563294 ZFINID:ZDB-GENE-070209-241 Length:410 Species:Danio rerio


Alignment Length:280 Identity:61/280 - (21%)
Similarity:109/280 - (38%) Gaps:66/280 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 TRLATQRLFAKSGYKP--QDVQVVEL----HDCFSANEL-----ITYEALGLCGEGNAGEFIDAG 326
            |||..|.....|..|.  :::|...|    |.....||:     :..:.:.|..||...|    .
Zfish   181 TRLTAQNAMMTSLSKKSLREIQTDRLKLGEHLGMDMNEMTKPWGLEVDRVELILEGVVRE----P 241

  Fly   327 DNTYGGKFVVNPSGGLISKGHPLGATGLAQCAELCWQLRGLAEKRQVPNAQLALQHNLGLGGAV- 390
            |..:.|..::.||                                 ||..:       ||.|.: 
Zfish   242 DGGHSGPLIMPPS---------------------------------VPGLE-------GLTGPIQ 266

  Fly   391 VVALYRLGFPAANSVVRNLTAAG---KAATSEDGFKVAPLLKLLEQAMQEDKDNLIEKVRAIYGF 452
            .:|::.|....|:...::..:..   .|.:|     |:.:.:|:|.......:.|:.:|.|.:.|
Zfish   267 QLAMHFLSQTTASQCTQDTVSFSDELHAVSS-----VSSVNELIETVRSVLSEELVHQVGACFHF 326

  Fly   453 KVNNGPNGQTGFWVIDAKQGKGKIIFNGTQK-CDVTFIISDDDVFELLTGKLPPQKAFFQGKIKI 516
            .:... :|||..:.:|..||:|.......|: .||:..:|:.|:..:..|.|.|..|:..|::::
Zfish   327 HITTN-SGQTSSYYVDLTQGRGACGAGVLQREPDVSLCMSEQDLLAMFQGSLQPFAAYSSGRLRV 390

  Fly   517 QGNMGFAMKLMDLQRSAQGR 536
            ||::..||||..|.:..:.|
Zfish   391 QGDLNTAMKLNTLIKLLKAR 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScpXNP_524715.2 PRK08256 5..396 CDD:181327 25/134 (19%)
SCP-x_thiolase 9..395 CDD:238425 25/133 (19%)
SCP2 429..529 CDD:280250 29/100 (29%)
stoml1NP_001103502.1 PHB 94..232 CDD:214581 11/50 (22%)
SPFH_SLP-1 109..239 CDD:259814 14/57 (25%)
SCP2 301..405 CDD:280250 30/104 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4170
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.