DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ScpX and hsdl2

DIOPT Version :9

Sequence 1:NP_524715.2 Gene:ScpX / 44183 FlyBaseID:FBgn0015808 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_001008673.1 Gene:hsdl2 / 493329 XenbaseID:XB-GENE-5753362 Length:417 Species:Xenopus tropicalis


Alignment Length:372 Identity:86/372 - (23%)
Similarity:141/372 - (37%) Gaps:116/372 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 TLEQIMKSPQVVEGV------LTKLQCCPTSDGSGAA--------ILASEAFVRRH---GLEKQA 243
            |||..||...::.|:      ||...|.|....|..|        :..:..:.:.|   .:.|..
 Frog   110 TLETPMKKVDLMMGINTRGTYLTSKICIPYLKKSKVAHILNLSPPLNLNPIWFKNHCAYTIAKYG 174

  Fly   244 VEIVGMEMASDPASTFA-----DKSLMKIAGTDM-------TRLATQRLFAKSGY----KPQDVQ 292
            :.:..:.|:.:.....|     .|:.:..|..||       .:..|..:.|.:.|    ||:|  
 Frog   175 MSMCALGMSEEYKGEIAVNALWPKTAIHTAAMDMLGGSGVDKQCRTPDIMADAAYAILSKPKD-- 237

  Fly   293 VVELHDCFSAN-----ELITYEALGLCGEGNAGEFIDAGDNTYGGKFVVNPSGGLISKGHPLGAT 352
                   |:.|     ||:.:|.:         :.:|.        :.|:|       ||||   
 Frog   238 -------FTGNFVIDEELLKHEGI---------KDLDV--------YAVSP-------GHPL--- 268

  Fly   353 GLAQCAELCWQLRGLAEKRQVPNAQLALQHNLGLGGAVVVALYRLGFPAANSVVRNLTAAGKA-A 416
                                :|:..|.....     |:..|:...|..||       ..|||| |
 Frog   269 --------------------LPDFFLDESPE-----ALASAMEEHGATAA-------FKAGKAQA 301

  Fly   417 TSEDGFKVAPLLKLLEQAMQEDKDNLIEKVRAIYGFKVNNGPNGQTGFWVIDAKQGKGKIIFNG- 480
            .|:|...:....|.:|..:.|:   .::..:.||.|.::   ..::|.|.:|.|.|||. :.:| 
 Frog   302 KSQDSSPLQETFKAIESLVNEE---AVKTTQGIYQFVLS---GEESGNWFLDLKNGKGG-VGSGE 359

  Fly   481 -TQKCDVTFIISDDDVFELLTGKLPPQKAFFQGKIKIQGNMGFAMKL 526
             :.|.||...:...|..::.|||:.|..||..||:||:|:||.|:||
 Frog   360 PSTKADVVMSMDSGDFIKMFTGKMKPTMAFMSGKLKIKGDMGLALKL 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScpXNP_524715.2 PRK08256 5..396 CDD:181327 42/237 (18%)
SCP-x_thiolase 9..395 CDD:238425 42/236 (18%)
SCP2 429..529 CDD:280250 34/100 (34%)
hsdl2NP_001008673.1 HSDL2_SDR_c 8..248 CDD:187663 28/146 (19%)
SCP2 313..410 CDD:376720 34/101 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.