DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ScpX and unc-24

DIOPT Version :10

Sequence 1:NP_524715.2 Gene:ScpX / 44183 FlyBaseID:FBgn0015808 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_001355386.1 Gene:unc-24 / 177594 WormBaseID:WBGene00006761 Length:443 Species:Caenorhabditis elegans


Alignment Length:40 Identity:9/40 - (22%)
Similarity:17/40 - (42%) Gaps:10/40 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 HWEPISHLCHPCLVHYNV----------IGKYETLTDDSS 37
            :::.:.|...|.::|..|          :.|.|...|||:
 Worm   184 YFDSVGHYSRPDVLHLTVNEHPRKSVTFVTKVEKAEDDSN 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScpXNP_524715.2 PRK08256 5..396 CDD:181327 9/40 (23%)
SCP2 428..531 CDD:460423
unc-24NP_001355386.1 SPFH_like 146..263 CDD:473137 9/40 (23%)
SCP2 357..439 CDD:442486
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.