DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ScpX and SCP2D1

DIOPT Version :9

Sequence 1:NP_524715.2 Gene:ScpX / 44183 FlyBaseID:FBgn0015808 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_848578.1 Gene:SCP2D1 / 140856 HGNCID:16211 Length:156 Species:Homo sapiens


Alignment Length:108 Identity:36/108 - (33%)
Similarity:58/108 - (53%) Gaps:6/108 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   422 FKVAPLLKLLEQAMQEDKDNLIEKVRAIYGFKVNNGPNGQTGF-WVIDAKQGKGKIIFNGTQK-- 483
            |:..|:.:.:...::|....|::||.|:  |:::...||:|.. |.||.|.|.|. ::.|..:  
Human    42 FESFPVFQDIRLHIREVGAQLVKKVNAV--FQLDITKNGKTILRWTIDLKNGSGD-MYPGPARLP 103

  Fly   484 CDVTFIISDDDVFELLTGKLPPQKAFFQGKIKIQGNMGFAMKL 526
            .|..|.|.:....||:.||:.|||||..||.|:.|.:..:.||
Human   104 ADTVFTIPESVFMELVLGKMNPQKAFLAGKFKVSGKVLLSWKL 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScpXNP_524715.2 PRK08256 5..396 CDD:181327
SCP-x_thiolase 9..395 CDD:238425
SCP2 429..529 CDD:280250 34/101 (34%)
SCP2D1NP_848578.1 SCP2 60..151 CDD:307934 33/90 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141952
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4170
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.