DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoip and DOCK4

DIOPT Version :9

Sequence 1:NP_001260293.1 Gene:hoip / 44173 FlyBaseID:FBgn0286786 Length:127 Species:Drosophila melanogaster
Sequence 2:XP_016868308.1 Gene:DOCK4 / 9732 HGNCID:19192 Length:2006 Species:Homo sapiens


Alignment Length:65 Identity:13/65 - (20%)
Similarity:28/65 - (43%) Gaps:0/65 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 AEPIEILLHLPLLCEDKNVPYVFVRSKQALGRACGVSRPIVACSVTTNEGSQLKSQITSIQQEIE 123
            |.|:......|.:|.:.....|.....:.:.|...:|.|.|....:::..||..:::::|..:.|
Human  1638 ASPVHFPNGSPRVCRNSAPASVSPDGTRVIPRRSPLSYPAVNRYSSSSLSSQASAEVSNITGQSE 1702

  Fly   124  123
            Human  1703  1702

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoipNP_001260293.1 SNU13 6..127 CDD:411046 13/65 (20%)
DOCK4XP_016868308.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.