powered by:
Protein Alignment hoip and DOCK4
DIOPT Version :9
Sequence 1: | NP_001260293.1 |
Gene: | hoip / 44173 |
FlyBaseID: | FBgn0286786 |
Length: | 127 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_016868308.1 |
Gene: | DOCK4 / 9732 |
HGNCID: | 19192 |
Length: | 2006 |
Species: | Homo sapiens |
Alignment Length: | 65 |
Identity: | 13/65 - (20%) |
Similarity: | 28/65 - (43%) |
Gaps: | 0/65 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 59 AEPIEILLHLPLLCEDKNVPYVFVRSKQALGRACGVSRPIVACSVTTNEGSQLKSQITSIQQEIE 123
|.|:......|.:|.:.....|.....:.:.|...:|.|.|....:::..||..:::::|..:.|
Human 1638 ASPVHFPNGSPRVCRNSAPASVSPDGTRVIPRRSPLSYPAVNRYSSSSLSSQASAEVSNITGQSE 1702
Fly 124 123
Human 1703 1702
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
hoip | NP_001260293.1 |
SNU13 |
6..127 |
CDD:411046 |
13/65 (20%) |
DOCK4 | XP_016868308.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1358 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.