DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoip and RPL8A

DIOPT Version :9

Sequence 1:NP_001260293.1 Gene:hoip / 44173 FlyBaseID:FBgn0286786 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_011830.1 Gene:RPL8A / 856352 SGDID:S000001025 Length:256 Species:Saccharomyces cerevisiae


Alignment Length:93 Identity:25/93 - (26%)
Similarity:43/93 - (46%) Gaps:13/93 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LRKGANEATKTLNRGLADIVVLAGDAEPIEILLHLPLLCEDKNVPYVFVRSKQALGRACGVSRPI 98
            ::.|.|.....:....|.:|::|.|.:|||:::.||.||:...|||..|:.|..||         
Yeast   132 VKYGLNHVVALIENKKAKLVLIANDVDPIELVVFLPALCKKMGVPYAIVKGKARLG--------- 187

  Fly    99 VACSVTTNEGSQLKSQITSIQQEIERLL 126
                ...|:.:...:.:|.::.|.|..|
Yeast   188 ----TLVNQKTSAVAALTEVRAEDEAAL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoipNP_001260293.1 SNU13 6..127 CDD:411046 25/93 (27%)
RPL8ANP_011830.1 PTZ00365 2..251 CDD:240382 25/93 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.