DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoip and AT5G20160

DIOPT Version :9

Sequence 1:NP_001260293.1 Gene:hoip / 44173 FlyBaseID:FBgn0286786 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_850856.1 Gene:AT5G20160 / 832138 AraportID:AT5G20160 Length:160 Species:Arabidopsis thaliana


Alignment Length:157 Identity:91/157 - (57%)
Similarity:111/157 - (70%) Gaps:32/157 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EEVNPKAFPLADAQLTAKIMNLLQQALNYNQLRKGANE--------------------------- 40
            |.|||||:||||:||:..|::|:|||.||.||:|||||                           
plant     4 EVVNPKAYPLADSQLSITILDLVQQATNYKQLKKGANEGIRLLLMCVCLSYLLSLMFVKLFLIYL 68

  Fly    41 -----ATKTLNRGLADIVVLAGDAEPIEILLHLPLLCEDKNVPYVFVRSKQALGRACGVSRPIVA 100
                 ||||||||:::.||:|.||||:|||||||||.||||||||||.|||||||||||:||::|
plant    69 NLFISATKTLNRGISEFVVMAADAEPLEILLHLPLLAEDKNVPYVFVPSKQALGRACGVTRPVIA 133

  Fly   101 CSVTTNEGSQLKSQITSIQQEIERLLV 127
            ||||:||.|||||||..::..||:||:
plant   134 CSVTSNEASQLKSQIQHLKDAIEKLLI 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoipNP_001260293.1 SNU13 6..127 CDD:411046 88/152 (58%)
AT5G20160NP_850856.1 Rpl7Ae 9..152 CDD:224277 83/142 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3672
Inparanoid 1 1.050 191 1.000 Inparanoid score I1382
OMA 1 1.010 - - QHG62158
OrthoDB 1 1.010 - - D1497609at2759
OrthoFinder 1 1.000 - - FOG0002761
OrthoInspector 1 1.000 - - otm2565
orthoMCL 1 0.900 - - OOG6_101116
Panther 1 1.100 - - LDO PTHR23105
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1617
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.