DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoip and AT4G22380

DIOPT Version :9

Sequence 1:NP_001260293.1 Gene:hoip / 44173 FlyBaseID:FBgn0286786 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_193969.1 Gene:AT4G22380 / 828333 AraportID:AT4G22380 Length:128 Species:Arabidopsis thaliana


Alignment Length:125 Identity:92/125 - (73%)
Similarity:111/125 - (88%) Gaps:0/125 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EEVNPKAFPLADAQLTAKIMNLLQQALNYNQLRKGANEATKTLNRGLADIVVLAGDAEPIEILLH 67
            |.|||||:||||:||:..||:|:|||.||.||:|||||||||||||:::.||:|.||||:|||||
plant     4 EVVNPKAYPLADSQLSITIMDLVQQATNYKQLKKGANEATKTLNRGISEFVVMAADAEPLEILLH 68

  Fly    68 LPLLCEDKNVPYVFVRSKQALGRACGVSRPIVACSVTTNEGSQLKSQITSIQQEIERLLV 127
            ||||.||||||||||.|||||||||||:||::|||||:||.|||||||..::..||:||:
plant    69 LPLLAEDKNVPYVFVPSKQALGRACGVTRPVIACSVTSNEASQLKSQIQHLKDAIEKLLI 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoipNP_001260293.1 SNU13 6..127 CDD:411046 89/120 (74%)
AT4G22380NP_193969.1 SNU13 7..128 CDD:411046 89/120 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1412
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3672
Inparanoid 1 1.050 191 1.000 Inparanoid score I1382
OMA 1 1.010 - - QHG62158
OrthoDB 1 1.010 - - D1497609at2759
OrthoFinder 1 1.000 - - FOG0002761
OrthoInspector 1 1.000 - - otm2565
orthoMCL 1 0.900 - - OOG6_101116
Panther 1 1.100 - - O PTHR23105
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1617
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.