DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoip and AT4G01790

DIOPT Version :9

Sequence 1:NP_001260293.1 Gene:hoip / 44173 FlyBaseID:FBgn0286786 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_192088.1 Gene:AT4G01790 / 827957 AraportID:AT4G01790 Length:167 Species:Arabidopsis thaliana


Alignment Length:123 Identity:30/123 - (24%)
Similarity:52/123 - (42%) Gaps:42/123 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VNPKAFPLADA------------QLTAKIMNLLQQAL------NYN----------QLRKGANEA 41
            :||:....||:            :|| .:::|:|:.:      |.|          |:..|.||.
plant     7 INPQKKIEADSNPVKESDYYEGERLT-HLLDLIQRGIETSKLSNVNSLPEKIWLKKQIAIGINEV 70

  Fly    42 TKTLNR----GLAD---------IVVLAGDAEPIEILLHLPLLCEDKNVPYVFVRSKQ 86
            |:.|.|    ..:|         :|:|..|.:|..:..|:|.|...:|||.::||..:
plant    71 TRVLERMNPNNTSDQQQNPKQLQVVILVADCKPRMLTKHIPNLAASRNVPVLYVRDNK 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoipNP_001260293.1 SNU13 6..127 CDD:411046 30/122 (25%)
AT4G01790NP_192088.1 Ribosomal_L7Ae 61..149 CDD:396000 20/68 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.