DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoip and AT4G01790

DIOPT Version :10

Sequence 1:NP_524714.1 Gene:hoip / 44173 FlyBaseID:FBgn0286786 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_192088.1 Gene:AT4G01790 / 827957 AraportID:AT4G01790 Length:167 Species:Arabidopsis thaliana


Alignment Length:123 Identity:30/123 - (24%)
Similarity:52/123 - (42%) Gaps:42/123 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VNPKAFPLADA------------QLTAKIMNLLQQAL------NYN----------QLRKGANEA 41
            :||:....||:            :|| .:::|:|:.:      |.|          |:..|.||.
plant     7 INPQKKIEADSNPVKESDYYEGERLT-HLLDLIQRGIETSKLSNVNSLPEKIWLKKQIAIGINEV 70

  Fly    42 TKTLNR----GLAD---------IVVLAGDAEPIEILLHLPLLCEDKNVPYVFVRSKQ 86
            |:.|.|    ..:|         :|:|..|.:|..:..|:|.|...:|||.::||..:
plant    71 TRVLERMNPNNTSDQQQNPKQLQVVILVADCKPRMLTKHIPNLAASRNVPVLYVRDNK 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoipNP_524714.1 SNU13 6..127 CDD:411046 30/122 (25%)
AT4G01790NP_192088.1 Ribosomal_L7Ae 61..149 CDD:426153 20/68 (29%)

Return to query results.
Submit another query.